SSO11003

Coordinates:2482081-2482206

>SSO11003 42 aa !not a gene!
MELHSHLLLVLAPLIYQLHLLLNNPDLTLHSLVSLMSRSDSL

>SSO11003 42 aa !not a gene!
GTGGAACTACATAGCCACCTTCTCCTTGTATTGGCTCCACTAATATACCAGCTACATCTCCTCCTAAATAACCCGGATTT
GACATTGCATAGTCTAGTAAGCTTAATGTCTCGTTCAGACAGTCTT


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2481581 - 2482706 (Additional range around SSO11003 is :500nt.)

>Sulfolobus solfataricus P2 TTATAAACCAACAACCCTCTCTTTAACGCTCGTTCTATAACTACCTTTGTTCCTTCGCTCCATGGTTCCTTACTGTCCTT AACTAACTCTATTCCTATCATAAAGCCCAAACCCCTTATATCGCCTACATGTGGATTTTGAACTTCTTTCAATAATTCTA AGGCTTTCCTACCCAATCTCTCAACTCTGGAAAGGATGTTATGACTCTCTATGAATTCTAAAGAAGCTAACCCGGCTGCA AGTCCTAAGGGATTTCCTCTGTAGGTACCGAGGTGAAACCCAGTTGGTAGTTTATCAAAGTCTTCCCTATATGCTACCAT TGAAACTGGTATTCCCTCACCTATTGCTTTGGAAATTGTCACTATATCCGGTTCAATATTTTCCCACTGATAAGCCCACA TTTTTCCAGTCCTTCCCACACCAGTCTGTACTTCATCTACTATTAGTGGTACTGAATACTTTTCAGCTAGTTCTTTTAGG CCTTTAAGGAAACCCTTAG GTGGAACTACATAGCCACCTTCTCCTTGTATTGGCTCCACTAATATACCAGCTACATCTC CTCCTAAATAACCCGGATTTGACATTGCATAGTCTAGTAAGCTTAATGTCTCGTTCAGACAGTCTT TGAATGGGCACCT ATAAGGATATGGATATGGAAACTTTACTACTCTATCATCAAAAAATGGCTGAAATTCCTTAAATCTATTAGCACCGGTGA GACCCAAAGTACCGGCAGTTATTCCATGATAAGACCCCTCAAATGCAATTATAGTCTTCTTTCCAGTTATGAATCTAGCT ATCTTTACTGCAGCTTCCACCGCATCTGCCCCAGTTGTAGTAAATAATAATTTAGCTCTCATTCCTAGAGTTGATAATAA TTTTTTACTAAAGTTAACCCTAATTTCCGTAGGTACCTCTAATGTGTGCCAAACCTTTTCTAACTGTTCTTGAACTCTCT TCCTCACAAAGGGATTATTATGACCTAGATTGACAACAGATATACCGGTAACCAGATCTATATACACATTACCATCAACA TCAGTTACTGTTGAACCTTGAGCCTTATCTATTGCTATCTTAAAGTACTTAGGGTAGTTTATAGCTGAAGTTTCATACTC TTCTTGG