SSO11019

Coordinates:2489308-2489454

>SSO11019 49 aa !not a gene!
MSILIPFCLTSFITVLNPLSFLIVSTLNPKISGLSTIYFMSDIETPINK

>SSO11019 49 aa !not a gene!
TTGTCAATCCTTATACCATTTTGTTTGACGTCATTTATAACAGTATTAAATCCGTTATCCTTTCTAATAGTTTCTACTTT
GAATCCGAAAATCTCAGGTCTCTCTACGATATACTTTATGTCAGATATTGAAACTCCCATTAATAAA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2488808 - 2489954 (Additional range around SSO11019 is :500nt.)

>Sulfolobus solfataricus P2 GGGTTTATTTTGTGGAGGTGCACATTTCACTGCAGAGGTTATATAAACGTTAAACAGTTTCAAGCCATCATCTTTGGATA CTGAAAATGGTTGATTTGAAAGTCCAACTGCATATAATGCGTTGGCTAGATTGTTTGAACTTTCATCCCCGGTAAACATT CTTCCAGTCCTATTTCCTCCGTTTCCTGCAGGAGCTAAACCTACAATTACTATTTCTGCATCAATTTGACCGTTTGGTGG AACAGGCTTTTTCCAATAGTTGTCGGGAAAGGATTTTCTATACTGTGTGAGTCTAGGGCATTTGTCACACGCAATTAGTC TAGATATGAAGTTTTCCACTAGTGTCTTTTATAATAAAAGGATTTTAAGCTTATATTTATAATTTAGACGTAACATACTT GATTATTGTTTTCTTTATAAAATTAACAATTATTAGAGAATTACTATTATCGTCAACTACCTCGCATTCACCATTATCCT TATTACATGTTACCCAATAG TTGTCAATCCTTATACCATTTTGTTTGACGTCATTTATAACAGTATTAAATCCGTTATC CTTTCTAATAGTTTCTACTTTGAATCCGAAAATCTCAGGTCTCTCTACGATATACTTTATGTCAGATATTGAAACTCCCA TTAATAAA TAGAAACTACATAGGAAAATATAAGCTCTATTCAATCTGATAAAAGAGATTCATTAACGTTATATGCATAA ATACTATCACTAACTTTTATCACTTTTATGTTATTATCGCTTATAGGTATTTCATAGGTTACACTATTATTATTTCCTTT TTCACCAAATATTATTGAGTTTTCATTAACCTCTCCGCAGTAGACCTTTGTTTGGGTGTCGCAAATTGCCACAAATACGA ATTTTCCATTGTTACAAATGCTTAGAAAGGATTGGCACTCTCTTTTATCTTTAGTTAAGGTGCCTAGTATTGCAGAATAA TCCATAAATTAGTATTTTTAATAAGATTTAAAAAGCATTATCACTAATAATACCAGTAACAAACAATAAGTATAGATTGC TCTTATAGGACATAGTTAGTTTAATCTTGTGTATTACCGTTTAAATGTTTAATAGATATTTTCTTAATAAACGTTTAAAT TTATTAATGTCTATATTTACTGTGATGA