SSO11026

Coordinates:2494557-2494841

>SSO11026 95 aa !not a gene!
MTISAAVIIPTSLLSLLNTGSLLTLFITISLAASIIVFSSPMDIMLLDITESTNPENIEDAISFKISLSVKIPTITLLST
TGIPPILFINIILTT

>SSO11026 95 aa !not a gene!
TTGACTATATCAGCTGCAGTAATTATACCAACGAGCCTGTTATCTTTGCTAAACACTGGCAGTCTCCTCACGTTATTCAT
CACCATTAGTTTGGCAGCATCCATTATTGTGTTCTCCTCACCTATGGATATTATGTTACTTGACATTACGGAATCTACTA
ATCCAGAGAACATTGAGGACGCTATCAGTTTCAAAATCTCTCTTTCGGTAAAAATACCCACGATAACGTTATTATCAACT
ACTGGAATTCCTCCAATATTGTTCATTAACATTATCCTAACTACA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2494057 - 2495341 (Additional range around SSO11026 is :500nt.)

>Sulfolobus solfataricus P2 GGAGGAAGACAGACACGGAGAAGATAGCTAGTAGTGGCTGAATCCTTTTTCATGTTAATAGAGATCTTTTTATTTCCATT TTTCTTATTATTTTTTAGTGATTCCAATCCAATAGAGGCGATGCACGAAGGGTTGGTTGATGTTAAGCAGAGATCTGAGT CCAGTGCAGTTAGGTTTGAAAGAGTCTCATGACTCACCTTTAGGGCTAAGTCCCTATACTCGATTGAACATAAAATGATT GGAATGAAAGTGAAGGGACAAACTGATCAAAAATAAATAAGTAAAAACGTTTTTATGCTATATTTATGTACGCATACATA AGGTCTCTTTCAGTAACTATTCCTACCAATTTTTGATTTTCCATAACTAGTAGTGTACCTATTCTCTTTTCTATCATTAA TTTAGCCGCATTCAGTATACTATAATATCTGTTTATAGTTATTGGATTTTTAGTTCCAGCATCTAGAACTTTTCCTATAT TTTTATTTTTAGCTAGATAT TTGACTATATCAGCTGCAGTAATTATACCAACGAGCCTGTTATCTTTGCTAAACACTGG CAGTCTCCTCACGTTATTCATCACCATTAGTTTGGCAGCATCCATTATTGTGTTCTCCTCACCTATGGATATTATGTTAC TTGACATTACGGAATCTACTAATCCAGAGAACATTGAGGACGCTATCAGTTTCAAAATCTCTCTTTCGGTAAAAATACCC ACGATAACGTTATTATCAACTACTGGAATTCCTCCAATATTGTTCATTAACATTATCCTAACTACA TGATTGACATCAT CATTAGGCGAGACAATAACTAAATCTTTACTCATTATATCCTTTACCTTTAAATCATATATATTAGTCCCATATTCGCTG AAAGAAGCAACAACATCCCTAGTAGAAACAATTCCAATAGGCTTTTCCTCCTTTAAAACAACAATTCTACCAGATGGATT ATTGGAAAGTATATCGATAGCCTCCTTTAAGGAGGATTCTGGGAAAATAGTTATTACAATAGGGTTAGCTATATCAATCA CTTTCATATGTAATATATTGTCATGATAGTTAAAAAACTTTCAAATAACAACTCTTGTGCTTTTCCCTACCTTCTCCACA TTTCTCAATAATTCCCTATAATCGCTTACAAAGGTAAAATTGTGCAATTTCATGTTTATCTCATAATAACCCTCTCTATC CTTAGCCTTGATCATCAGCCTATCGTTCCTATAACTTACACTATAGTAGAGTGAGCTTGAGGACAACGTTACTTCACTAT CCCCAT