SSO11031

Coordinates:2497711-2497830

>SSO11031 40 aa !not a gene!
MTPPLTKESLIDKNSLKSALSQYLESSNLLVSPKIGGAEG

>SSO11031 40 aa !not a gene!
TTGACACCACCTCTCACTAAGGAAAGCCTCATTGATAAGAACTCACTTAAGTCAGCATTGAGCCAATATTTGGAATCTTC
AAACTTACTCGTATCCCCTAAAATTGGTGGGGCAGAGGGA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2497211 - 2498330 (Additional range around SSO11031 is :500nt.)

>Sulfolobus solfataricus P2 AAAGCTCCAATCTCTAGGAAGAAGAATTGCGATGAAAAGATTCTTATTATATTTTCTGAAATAAACTTCAACCTTGTCTA TCGTGTCATAATTCTTTATATTCTCAATTAGAGTATCGGAAATAGCCTTATCCACTGCTGTTATACTCCATCTAGTAGGT ACTAATTTTCTTTCCTTTCCAATTCCACCAATACTTAATATCCTGGATATTTTTTCTACGTCAATCCCTGCATTATATAA TTTCATTATACCATCTTTTGCCCTCATATCGTTATCAACATAAACCTTCTCTACTACTGCTAAGGGAGGAGGCAATGTGG CTATCTCAAGCTTTTCCAATGGTGCTGAAGGACCTAGAGGTGGCAGACTTTCATCTAAAATACCTCCAGAAGGTATTCTC TTCAGCCTTAAATCCAATTCAACTGGTCTCGATGATATTGTTATACTCTGAATATCTAGTAAAAACCTATCTGGTAGTCT TGCATCATCTTTGTGATAT TTGACACCACCTCTCACTAAGGAAAGCCTCATTGATAAGAACTCACTTAAGTCAGCATTG AGCCAATATTTGGAATCTTCAAACTTACTCGTATCCCCTAAAATTGGTGGGGCAGAGGGA TAAACTGTAATTTTGGGAT AACTAAATCTACCTACAAAGACGGATGGTGGGGAAGAACCATATACCTCCTTGAAATTTACTCTTACCGTTTTAGTATTA ACTATGATTGGACAGTATGAAAGACCGCAAAGATACTTTGCCCCTCTACATCTTATGCATAACTCTGGCCTTATCACTAA TTTAATCTTACTCTCTTATCTATATAATATTTTTATCAGTTAACGTGTCGTTAAGCTCTTTTATTGCAATTACCAATTGC GCATGAACAAAAATCTGAGGAAAGTTACCCGTAAACTCCCCTTTTTCCACATCAACGTGTTCACCTACTAAATGTAGTTC TCTTGAAACCTTATTGATCTTATTCAAGATTTCTATAGCACTATCTATTTTTCCTAATCTCATATAAACTCTAGCAAGCC ACACTGTAGTCAACAAAAATGGGTGTTTAGCTTCTCCCATGAAATCAGTTTTGTATCTTTTCACAAATACGTCGGTTTTT A