SSO11036

Coordinates:2498455-2498709

>SSO11036 85 aa !not a gene!
MVLKESNDLLNHCFKSDLNNLLTKFKAVLMSSNTTGLPLNISLTFSLTNQTPTGKLNPSYISLHNIAVACLFLLAKNSVT
PNLEA

>SSO11036 85 aa !not a gene!
ATGGTATTAAAGGAGAGTAATGACTTACTTAACCACTGCTTTAAATCAGATCTTAATAATCTTTTAACGAAATTTAAGGC
AGTACTTATGTCGTCAAATACTACTGGCTTACCTTTAAACATTTCCTTAACGTTTTCCCTAACAAACCAAACACCTACTG
GCAAGTTAAATCCTTCATATATCTCCCTCCATAATATTGCAGTGGCTTGTCTCTTTCTGCTTGCCAAGAATTCCGTCACA
CCTAATCTAGAAGCA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2497955 - 2499209 (Additional range around SSO11036 is :500nt.)

>Sulfolobus solfataricus P2 CTAAGGCTCTTAATCTACCTTTAGCTGGAGGTGCGTTAGGTTCTAACTTATTATTTAAACTAGTAACTGTAAATCCAACA TCAACTCTATCCTTGTATTCTAAGAGTACGTCAATATCCCTTAAAACTAAGGGTGACTTAGTCTGAATTGAAACTCTGAA ACCATTCTTTAATAATATCTTTAGGCTTTCCCTAGTAAGCTTTCTTAAAGCCTCTATCGGTTGATAAGCATCAGTTATTG TAGATATCCCAACTACTCCCCTCTTATAGATTTTCACTTCTCTCTCTAAAACCTCAAGCAAGTTCTCCTTAACGGCTACA ACTTTCCCCCAATTTTCTGAAGCCTCCCTATCTGGAGTGAAATTGGGGGCATAACAATAGGGGCAAGAAAATACACAACC TAAATAAGGATTTAGACTATAGTTTAACTCTTTCAATCCAGATTTACTTAAAGCAGATTTCACCCTAATGGACTTTACAA TCATTTTAACCACTTATCA ATGGTATTAAAGGAGAGTAATGACTTACTTAACCACTGCTTTAAATCAGATCTTAATAAT CTTTTAACGAAATTTAAGGCAGTACTTATGTCGTCAAATACTACTGGCTTACCTTTAAACATTTCCTTAACGTTTTCCCT AACAAACCAAACACCTACTGGCAAGTTAAATCCTTCATATATCTCCCTCCATAATATTGCAGTGGCTTGTCTCTTTCTGC TTGCCAAGAATTCCGTCACACCTAATCTAGAAGCA TAATAACAACCGCCTATTTCTGGATAATCAGATCTACCATGATA CCTTTCGTTATCCACTTCTATATCAACATAGTTGCCAAACTTATTCCAGGTACTTCCAGGATACCAGGCTTCTCCCCATT CAAAGCTCCAATCTCTAGGAAGAAGAATTGCGATGAAAAGATTCTTATTATATTTTCTGAAATAAACTTCAACCTTGTCT ATCGTGTCATAATTCTTTATATTCTCAATTAGAGTATCGGAAATAGCCTTATCCACTGCTGTTATACTCCATCTAGTAGG TACTAATTTTCTTTCCTTTCCAATTCCACCAATACTTAATATCCTGGATATTTTTTCTACGTCAATCCCTGCATTATATA ATTTCATTATACCATCTTTTGCCCTCATATCGTTATCAACATAAACCTTCTCTACTACTGCTAAGGGAGGAGGCAATGTG GCTATCTCAAGCTTTTCCAATGGTGCTGAAGGACCTAGAGGTGGCAGACTTTCATC