SSO11037

Coordinates:2499664-2499864

>SSO11037 67 aa !not a gene!
MKDSASTVPIKVLAATIFATISAISLDIGPLYSTSFPSGVYCPAAIAPFNCISLSSFSLIFYTSTKY

>SSO11037 67 aa !not a gene!
GTGAAAGACTCTGCTTCCACAGTTCCCATTAAAGTGTTAGCTGCCACCATCTTTGCTACCATCTCAGCAATCTCTTTAGA
CATCGGTCCCTTATACTCTACAAGTTTCCCATCCGGTGTATATTGTCCAGCTGCTATTGCTCCTTTTAATTGCATTAGTT
TATCGAGCTTTTCACTCATTTTTTATACCTCTACTAAATAT


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2499164 - 2500364 (Additional range around SSO11037 is :500nt.)

>Sulfolobus solfataricus P2 TAGAACCTAACGCACCTCCAGCTAAAGGTAGATTAAGAGCCTTAGAGGAACTCAGTAATGAAGGGCTGGAAACTTGGATT TTCCTAGGACCTATTATTCAAGGTGTAAATGATACTGAGGTAGAGAATATAATTCGTGAAATTTCAAATATCAAAGCAAG GGTAATTTTCGATAGTTTTCATTACTATAGGGGGTTAAAATTTAAGGAGGGTTCTATACATTGGTGGGTTAATTTGAAGA ATAAAATATTAGAGAATTGTAAGAGGTACAGTATAGAGTGCCATGAACAAAGTGAGGACTGGATTTATGAAAAAAAGAGA TATTATAAAACCTTTTAGCCTTATATTCCGGCTACTTCTCTTAATGTTTTGAATATTTGATTGAAATCTGCCTCAGCAAG TTTAACAAACACTCCATAATTTCCCATTACGCATACTGCATACTCTCCTGCAGCTACAGCCCACCCTAAAAACGGAGTCC ATCTCATTCCAGAAATTTTC GTGAAAGACTCTGCTTCCACAGTTCCCATTAAAGTGTTAGCTGCCACCATCTTTGCTAC CATCTCAGCAATCTCTTTAGACATCGGTCCCTTATACTCTACAAGTTTCCCATCCGGTGTATATTGTCCAGCTGCTATTG CTCCTTTTAATTGCATTAGTTTATCGAGCTTTTCACTCATTTTTTATACCTCTACTAAATAT TAGATAAATCATTTTAA TAAATTTTATGATTAAACATTATAAAAAATCATAATATATCAAGTTTTATCTTATTTATTTTCTCTAGGGTTTAACTAAA TAGCATATGAAGTCGTCCTAAAAGTCACATCGATAAAATATCATAAAGTTTAAATATTAGTTTATTTTTACTAAAAATTA AGATAAAATCATCCTTCCTCTAGATATCTAAATATCCACGAAGCAAATAAGAGTATTATCCCCGCTGTTATAAAATCTAT ACCGTAGCTGATATAGTGCGTGATATAACCTGACAAAAGCGATCCTAGAAATAACGATATCCCTACTACAGTACTGTAAA CTCCGAGCCCAGTTCCTTGTCTCCTCTCCCCAACAATTTTGAATATTAAGGTAGTAGATGAGGAGTAGAAAATTGCATAG GCAATTCCAGCTGCCAACGGATAAAATATTAACCCAGATATAAATATTGGTATACCTAAAAATAATTGAGCAAATATACC AA