SSO11047

Coordinates:2505012-2505158

>SSO11047 49 aa !not a gene!
MVECPLLDLYNRLLQFPLCPHLLTRHLEEFCSPLFSFLLLNQKPCCKPQ

>SSO11047 49 aa !not a gene!
TTGGTAGAATGTCCTCTGTTAGATCTTTACAATAGGCTTCTACAATTTCCTTTATGTCCTCACTTGTTAACGCGTCATCT
AGAGGAATTCTGCTCTCCTCTATTCTCCTTCTTATTGCTAAATCAGAAACCTTGCTGTAAACCTCAG


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2504512 - 2505658 (Additional range around SSO11047 is :500nt.)

>Sulfolobus solfataricus P2 TAGCGTAGGGATATTTAGTGTGTAAATGTTATTAATATTAGTAGCGGTGTTTGTTATTACGAATCTTCCCCTAACCTTAT ATACTTTCTTATCATGTTCCACTTCCTCAATTTTGCTTAACAATTTCAATTCCTCATAGTTATATAAGCTTCCGTCATTT GAAAATACTACATCTCCCAAGTATACTTGATCATCCACAATGAAGAATAAGCCTACTACAATAGACTTTCCGTCAACTTC AATTCTCTTTCCTCTTGGATGAACATAGCTTATTCCAAACTCTTTACTAATATTGGATAGTAACTCTCTAACCTTCTTTT CAAATTCCTTAGCGTCAACTTCTGGATTCCTTAGACTTGTATATTTTCTCAATTCACTTCTAATACAATCTATGTTATTT TTCTCACAAACTTTTTCTACCTTATCCATCTCATTTCGTATGAACTGTAATATTGAACTGACATTAGTTATCTCTTTACT ATTCCATAGTGTTATAATTA TTGGTAGAATGTCCTCTGTTAGATCTTTACAATAGGCTTCTACAATTTCCTTTATGTCC TCACTTGTTAACGCGTCATCTAGAGGAATTCTGCTCTCCTCTATTCTCCTTCTTATTGCTAAATCAGAAACCTTGCTGTA AACCTCAG TAGGCATTGCCATAATTATCGGTATATCAAGTCCTGCGTTAATTAGCCTGTGTATTAGACTTAAGTGATAA TCCCTTATTTCATCAATTAAAAGTACTAGCTTACTCAAATTCTTCATATCTCTTAACGCATTAATCATTCCGTCGAAGTT TCTTTCATAGCTCAAACAATAAACCCTTAGAAAGGGATTATTATATTTATTGCAAATTTTTAGCAACCAATCCTCAAATT TAACTCCCATCAATCTTTTCCAAAAAGAATATCCAAGCTTACCCTTTATCTTCTGCAGTTCAAGTAAAGCCTTTTCCCTC AATTCGAATTGAGTAGTCTTAGTCCAGAATTCCTCATCTATACTTTGTTTATTAGCTAAGTCTAAGTAAATTGATAAGTT ATCAGTTTTTGTTATTTCCTCTATTTTCTTAAGTAACGTAGTCTTTCCCATACCAGGTTGTCCAACAACTGATGCCACTT CGTTATTTCTTACTATTTCTAGTGTCTT