SSO11060

Coordinates:2509562-2509711

>SSO11060 50 aa !not a gene!
MYSPPISISTPSLDLGFLNIKPLLALIIAGVIRPYSKNGFISTFRSISLS

>SSO11060 50 aa !not a gene!
ATGTATTCCCCACCTATTAGTATTTCCACGCCCTCTTTGGATTTAGGATTTCTAAATATCAAGCCTCTTCTAGCTTTAAT
TATAGCTGGTGTTATAAGGCCGTATTCAAAGAATGGCTTTATCTCTACTTTCAGATCTATTTCACTTTCA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2509062 - 2510211 (Additional range around SSO11060 is :500nt.)

>Sulfolobus solfataricus P2 AATCTAGGATTTCCTCTGCTGGTGGCGCTGTTCCATCTATTGTATAAAGTGGATGATCAAAACTTTTAGACGAAGGATCT ATCATAGCAGTTAGGAATCCTATTATATCCCTGGCCTTTACCAATAATCCTGCTTTTATTAACGCTTCTGCAGAGTACGA AGCATCTCTAACCCATACATATCTATAATCCCAATTTCTCGACCCGCCGATTATCTCTGGAAGAGAAGTAGTTGGAGCTG CTATAATTCCTCCTGATGGTTCATAAATTAAGCCAAGAAGTACTAACAAAGATCTATAATATGCATCTACATACATGTTA ACCTTTTTAGCGTTCTCTAACCTTCTTCTCCAATATCTTATAGCCTTATTTAAGGCTTCATACGGTTCAGAATAAACAAA GCCCTTATTACTGAACAGACCATATCTCAAATCCTTCGAGTAAAGCAAGTATATATAACCTTTACCCTTTTTCAAAACGA ATTCAGTATCATCAATAGGT ATGTATTCCCCACCTATTAGTATTTCCACGCCCTCTTTGGATTTAGGATTTCTAAATAT CAAGCCTCTTCTAGCTTTAATTATAGCTGGTGTTATAAGGCCGTATTCAAAGAATGGCTTTATCTCTACTTTCAGATCTA TTTCACTTTCA TAAATTCGTATAATCCCTGCTAACGATAAAGGTAAGAAGTCCGTTACTTCAGCTTTACCCTCCTCGCT TTTGAAGATAGTTCTTAGAATCAATGTATTTTCAATATAATCTTCATGAATTACCTCATATTTTTCATCTACCGGACTTA TACTGAAATACCCTCCTCTTTCTTCATCCAGAATTTTTGTGAAAATTGATGAAGAATCAAATCTAGGTAATGGTAACCAT TCAACACTGCCATTTTTTATTAAAGCTGAGGTGATACCGTTCGAAAGAAATTCGTAATATCTTGTCACGTGAGTAGTAAG GAATTTACCCTAAAAAATTTAGTCTTAATTGTTGAAAGTTAAATTAATCTGGAGAAGCCCATGACTAAACTAGTGTTTGC TATATAGATGAGAGGAAGTTTTCAGAAAATAACCTATGGAGGAGAGTTAATATAAGCTAGTATATTTGCACTAGTGTGGT TTTTGAGAGAATTACTACTATATTGCAATTG