SSO11070

Coordinates:2513759-2514013

>SSO11070 85 aa !not a gene!
MFTHHTYSLHWTYIRTNSTTFTILVINSYFTVAWHYCRFWAEHKTRFTAYAFTIVNYRLYYPPCSGSSSSTLIRSSYWKV
LIFKQ

>SSO11070 85 aa !not a gene!
TTGTTCACTCACCATACTTATAGCCTTCACTGGACATACATTCGCACAAACTCCACAACCTTTACAATACTCGTAATCAA
CTCTTACTTTACCGTTGCTTGGCACTATTGTAGATTCTGGGCAGAACATAAAACACGCTTTACAGCCTATGCATTTACTA
TAGTCAACTACAGGCTTTACTATCCTCCATGCTCCGGTTCTTCCTCCAGCACCCTTATTAGGTCTAGTTATTGGAAAGTA
CTGATATTCAAGCAG


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2513259 - 2514513 (Additional range around SSO11070 is :500nt.)

>Sulfolobus solfataricus P2 ATCCATACCGATCATCATTGGTAGGAACACTCTTTCGTCTTCTGAGATCCTAAATGCTTGTAAAGTCAGATCTAATGCTT CTTGTGGATTACTCGCAAATGCCATTATCCATCCACTATCTCTCTCGCTCGTAAAGTCCGTGTGCTCATTCCATATGTTC CATGGAGCTCCTACGGCTCTAGTACCTACAACCATCACTACTGGTACTCTACTCCCAGCAACCCACCACACCATTTCGTG CATGTAAAGTAGACCCTGGGATGCGGTAGCAGTAAAGGCCCTAACACCGCCTAAGGCAGCACCAAACGTTGCAGCCATTG CAGAATGTTCACTCTCGACTCTCACTATTTCGGTTTCAATTTCACCTTTAGCTCTCATCTCTGCCAATTTCTCAATTATT GTGGTTTGTGGTGTTATTGGGTATATTCCAGTAACTCCTACTCTCGCTAGTTTTACGCCTAAGGCTACAGCCTCATTTCC GGAAATAATTTTTCTAATCA TTGTTCACTCACCATACTTATAGCCTTCACTGGACATACATTCGCACAAACTCCACAAC CTTTACAATACTCGTAATCAACTCTTACTTTACCGTTGCTTGGCACTATTGTAGATTCTGGGCAGAACATAAAACACGCT TTACAGCCTATGCATTTACTATAGTCAACTACAGGCTTTACTATCCTCCATGCTCCGGTTCTTCCTCCAGCACCCTTATT AGGTCTAGTTATTGGAAAGTACTGATATTCAAGCAG TGACATACTCGACACCAACTTGTCCATAGGCTAATCTTGCACC TTTTATGTTGAGTTGAGCTACTTTACCATCAAATTCCTCTTCTATTGCTTTCTCAAGTGAAGACAGTTTAGGCATTCCCA TTACCCTTATTAGGGCTCCCAAGATAATTACGTTCACCATGGGCCATCCTGATTTCACCAAACCTAAATCTGTCGCAATT TTGGTTGCATTAACGTAAAAAGTTCTCCACCTAAGATCTGGTTTAGAAGGTGAATTTAATAATATTGTGGAAGTATCTTT TAGTCCTCTGAATAAACTCCTTGATATTTGGATAAGGGAATTGTCTATTACTACTAAGTAATCTGGTTCTTCAACTGGAG AAGTTACCCTAATAGGCGTATCGGATATTCTACAATAAGCCTCTATCTCTGCGCCTCTCCTTTCTGCTCCATAAATGGGA AAAGAAGAAGTATAAAGATTTTCATACCCTGCAGCTTCAGCTAATAGCTGGGAAGC