SSO11079

Coordinates:2516624-2516827

>SSO11079 68 aa !not a gene!
MIVTETSNPISSPIKYDLLYIILTASLTLIDLLPIFTVPLSIFTSSFSTLNILAKYSLIFSFNFREAM

>SSO11079 68 aa !not a gene!
TTGATAGTGACCGAAACATCTAATCCGATCTCATCTCCTATCAAATACGATCTGTTATATATCATATTAACGGCTTCCTT
AACATTAATTGATCTGTTACCTATTTTTACTGTTCCATTATCTATTTTTACATCATCCTTTTCTACGTTAAACATCTTGG
CTAAATACTCTCTCATTTTTTCCTTTAATTTTAGGGAAGCAATG


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2516124 - 2517327 (Additional range around SSO11079 is :500nt.)

>Sulfolobus solfataricus P2 TCATGTCATTAATTAGCTGCAATACATACTCAGGGGTTATTGGTATTTCAACCCTATTGATAGGTTTCTTCACTATATCC TCTAAGGCATTAATAATTGCAGCTGGAGGTACAGTTGCTCCTCCTTCAGCAACGCCTTTGGTCCCTAGTGGTGTGAAAGG TGAGGGGTTTATCATATGCTGTATCTCGAAATTAGGTACCTCTTCTGCTGAAGGAATCCAATAATCTGCAAAAGAGGTTT GCTTTGGAATTCCGTTTTCATCGTATTCCACTTTTTCTAAGAGTGATGCTCCTATCCCCATGGTAGTACCTCCCATTAAT TGCCCATCGACTATCATGGGGTTTATCATAGTTCCGCAATCACTTAATATCACGTACTTGAGGATTTTTATAAACCCTGT ATCCTTATCGACCCTAATTACTATACCGTGCGCATTGACACCATAGGTTGTAGAGAAATTCACTCTTCTCTTCTCGTCTG CAATATTCACGTTATATGAA TTGATAGTGACCGAAACATCTAATCCGATCTCATCTCCTATCAAATACGATCTGTTATA TATCATATTAACGGCTTCCTTAACATTAATTGATCTGTTACCTATTTTTACTGTTCCATTATCTATTTTTACATCATCCT TTTCTACGTTAAACATCTTGGCTAAATACTCTCTCATTTTTTCCTTTAATTTTAGGGAAGCAATG TAAACAGCTGAAAT ACCTACTACAGAGAACCTACTACCGTAAAATCCAGTACCTGGCGGACCGGCAGTATCACCTAAGATGACCTTTACATCCT CAATTGGTATACCTAGAACATCAGCAACCACTTGGGATATTGCAGTCTCATGTCCAGTACCCATAGTATTAGTTGAAAGA AACACCGTAACATCACCTCCGCTATCTATCCTCATGTAAACTCCTTCATAATAGGGTGTTCTAGGCTTGTTAACTACTAG TGTTTGGAATGCTAATGAAGATCCAGGTTCTAAGGCGAATGCTATTCCAACTCCCGTGTACTTATCCTTATCCTTAACTT CTAGTTGGCTTATGAGTTTCTTTAATGCCTCTCTGTAATTCCCACTGTCGTATATTGCACCGGTTATGTGTTCATAAGGA AGTTTATCGATGAAATTCTTCGTTCTTAATTCTATCTCATCAATGCCATTTACTTTGGAAATACTTTTCACAAGGTTTTC TAAAA