SSO11083

Coordinates:2517743-2517898

>SSO11083 52 aa !not a gene!
MKIMLRAVLKTCGTCVFAYIVKFPLTLSKSAITPLVSRGAGKILLYLNVFST

>SSO11083 52 aa !not a gene!
TTGAAGATAATGCTTAGGGCTGTCTTAAAGACTTGCGGAACTTGCGTATTTGCATATATTGTCAAGTTTCCGCTAACCTT
ATCGAAGTCAGCTATAACCCCATTGGTTTCAAGAGGCGCCGGCAAAATCCTATTATATCTAAACGTCTTTTCTACG


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2517243 - 2518398 (Additional range around SSO11083 is :500nt.)

>Sulfolobus solfataricus P2 GTTTATCGATGAAATTCTTCGTTCTTAATTCTATCTCATCAATGCCATTTACTTTGGAAATACTTTTCACAAGGTTTTCT AAAACTAGCACTGCCGGTGGGATTCCCAATCCCCTATATGCCCCAGTCGGAGGTTTATTCGTAACTACTCCAGATACTCT AAACTTGAGGTATTTCATCTTATACGGTCCTACTAGTTGGTATATTTGTCTGAGAATCGGTAAGGGTTGGTAGGTATGTA AATACGCTCCAAAGTCTTCCACTAGGTCAACTATTGCTCCCAATATTTCATCCCCCTTAAATAGAATCTTGGCAGTGTAA TGTCTATCTGGCCCGTGGATTGCAGAAATTACATGCTCATATCTAGTCTCTATATACTTTACTGGTCTTCCAGTTAATAT CGAAGCTAGGGCGGTCATAGCTAGAGGTTTCAGGAAAATTTTTCCACCAAATCCCCCTCCAGAATCTGGGACGATAATTC TGACTTTAGATCTAGGAATA TTGAAGATAATGCTTAGGGCTGTCTTAAAGACTTGCGGAACTTGCGTATTTGCATATAT TGTCAAGTTTCCGCTAACCTTATCGAAGTCAGCTATAACCCCATTGGTTTCAAGAGGCGCCGGCAAAATCCTATTATATC TAAACGTCTTTTCTACG TAGTGGTAATCCTTTGGTTCCTCTCCATATTCGAAAATATCACTATACACAATGTTAGAGCC AAGTTCCTTATGAAGAATAAGTGAATTAGGTTCTATCGCCTTGAATGGATCAGTTATTGGTTCTATAGGTTCATAATCCA CATCAACCAGTTCTAAGGCATCGTAAACCTCATATCTATCCCTACCTAGCACTAACGCTATTGGTTCGCCAAAATACTTA GCCTCTTCCTTGGCTAAAATATATTCCTTAGGTGCTCTCTTAGGATCAGGTATGAAAAAATTAGGTAATGGCGAAAATTC CTTCGTATCTTCAAATGTTATTACGTTAAATCCTCTTTCCTCGGCTCTTTTGGGATCAAGCTTAAATTTAGCCCAAGCGT AATTCGACCTTAATACTGCCATGTATTGCATATTTGGTAAGTAAATGTCGTCTATGTATCTACCTTTTCCAGTTAAAAAT CGTAAATCTTCAACTCTCTTAACTGAACTACCAATAT