SSO11086

Coordinates:2518594-2518734

>SSO11086 47 aa !not a gene!
MDINLANEAATVYSFSFPFLNSVPAQYVISLATSKSANDSETLVCTN

>SSO11086 47 aa !not a gene!
GTGGATATAAATTTAGCCAATGAAGCAGCAACAGTGTATTCGTTTTCTTTCCCATTTCTAAACAGCGTCCCAGCCCAATA
TGTTATTAGCCTAGCTACCTCCAAATCTGCTAATGATTCAGAAACTTTAGTCTGTACTAAT


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2518094 - 2519234 (Additional range around SSO11086 is :500nt.)

>Sulfolobus solfataricus P2 AACGCTATTGGTTCGCCAAAATACTTAGCCTCTTCCTTGGCTAAAATATATTCCTTAGGTGCTCTCTTAGGATCAGGTAT GAAAAAATTAGGTAATGGCGAAAATTCCTTCGTATCTTCAAATGTTATTACGTTAAATCCTCTTTCCTCGGCTCTTTTGG GATCAAGCTTAAATTTAGCCCAAGCGTAATTCGACCTTAATACTGCCATGTATTGCATATTTGGTAAGTAAATGTCGTCT ATGTATCTACCTTTTCCAGTTAAAAATCGTAAATCTTCAACTCTCTTAACTGAACTACCAATATACACGGTCACACCTTA TATCCAATGAATTTATTATAGAGGAACCTTGCCGCGCTTATTCTTTGAATATCGTTTGTCCCTTCATATGTTTTCATAAT TTGTAAATCTCTTAACATTCTCTCCAGTCCGGTAGATGTAGTAACACCGTAACCCCCATATACACTCATAGCCCTTAATA TAATCCTCTCAGCAGATTCC GTGGATATAAATTTAGCCAATGAAGCAGCAACAGTGTATTCGTTTTCTTTCCCATTTCT AAACAGCGTCCCAGCCCAATATGTTATTAGCCTAGCTACCTCCAAATCTGCTAATGATTCAGAAACTTTAGTCTGTACTA AT TGAAATTCTGCTAGTTTCTTTTCGAATGCAGATCTTTGAAGTGAATAATTAATCATTTTCTCCAAAGCGGCTTGTCC AATCCCTAATGCTTGTGAAGCAACTATGGTTCTAGCAAAATCAAAAGAACTTACTGCATATTTAAATCCATTACCTTCCT CTCCAAGTAGATTTTCAGTCTGTACTTTTACATCTTCCAATAAAATCTCGGCAGTATGCGAAGATCTTAGCCCAGTAGTT TCAATTCTACTCACTGGTTTTACAGCATCCTTCTCTACAACAAACATCGAAATTCCTTTCCATCTAGCCTTAGGATCTGG AGGTGAAGTTCTAGCGGCTATTAAGTAATAATCCGCAATATCGCCATTGGTTATGAAAATCTTCCTGCCATTTATTACAT ATTCGCCATCTAATTTCTTTGCAGTTGTCTTTATACCAGCTACATCTGAACCAGCTACTGGTTCAGTAACAGCAAATGCT GCTACTTTATCTCCATTGGCAA