SSO11096

Coordinates:2523212-2523451

>SSO11096 80 aa !not a gene!
MTLSLDNFLLNQLTLIVHQDLLKVLTLIVFVLKNIMPHLIQQSLPQLLLYHMSLTAYYISFILYIIKSYLLIVCKKVKYE

>SSO11096 80 aa !not a gene!
TTGACTCTATCCCTGGATAATTTTCTATTAAATCAGTTAACGTTAATTGTCCACCAAGATCTTTTGAAAGTACTAACGTT
GATAGTTTTTGTCTTGAAGAATATAATGCCGCACTTAATCCAGCAATCCCTGCCCCAACTATTATTGTATCATATGTCTT
TAACGGCATACTATATCTCTTTTATACTTTATATAATAAAAAGTTATCTTTTGATAGTCTGTAAAAAAGTTAAGTATGAA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2522712 - 2523951 (Additional range around SSO11096 is :500nt.)

>Sulfolobus solfataricus P2 ATTTCATCCCCTCTCTTTATCACTAACTCTTCAACCTTACTATTCCCTCTTATTTCTAAGACTCTTGAAGATGTTAATAT TTTAACTGTGGGTTTATTCACTACATTTTTTACAATCTCCTCCTCACCTGCTAGATAAGAAGATGAGGTAATATAATATG CTGGGTTTGCGTAATTTGATAACAATTCTATAGCTTCTATTCCAGGTTCACCTTCGCCTATTACAGCCGCTGGCTTACCC TTGAAGAATGCTGCATCACATATTGCACAGTATGATACCCCTTTCCCTTTAAACTCTTGCTCACCTGGTACATTAATTTC CCTTGGAGTTTTACCAAACGCTAAAATTAGAGCCCTTCCAGCATATTCACCTTTAATACCCTTTATTATGAATAAATCCG ACTCTTGTGCGATCTCTTTAACTTCCTCTCCATAAATGAATTCCGCTCCGAACTTCTTAGCTTGTTTCTCAATCTTTTGC GCTAGAGTTAACCCTCCGG TTGACTCTATCCCTGGATAATTTTCTATTAAATCAGTTAACGTTAATTGTCCACCAAGAT CTTTTGAAAGTACTAACGTTGATAGTTTTTGTCTTGAAGAATATAATGCCGCACTTAATCCAGCAATCCCTGCCCCAACT ATTATTGTATCATATGTCTTTAACGGCATACTATATCTCTTTTATACTTTATATAATAAAAAGTTATCTTTTGATAGTCT GTAAAAAAGTTAAGTATGAA TAAAAAATCTACTTAGTGTTTAAACCGCTCCTTTATCCAGTGCCTCACATCGTAAAAGA AAATGTTGTCATATGGACAGGCGTTCACGCATTCCCCTAATCCAACACACTTAAACGACTTAAACTCTCCCTTCTTTATA AACCATCCTCTCATATCTGTAATCCCAACTGGACAAGCAGATGCACAATCTACTGTTTTACAATTAACGCATATCATTGG ATCCTTAACCTTTAGTCTAAATAAACCTATACTACTAACGGCTTGATTAAACACGCCCCAATAACAATATCCAGTATTAA TGCACGCAAATGTACCTAAGAATGGTATAGAAATGAATAGGAGATACCAGATTATATCAAACCAAATGAAATATATTAGA ACTGTAATATCAGCGCCGAATATTGTAAAATTAATTATGCCTAACGAATTAAGATAAGATATAATGGAAGCCACTAATAC CAATATTGAAATGCTGAGCGTTACAATTTTGAACCAGTTTG