SSO11108

Coordinates:2529113-2529241

>SSO11108 43 aa !not a gene!
MTNDASSPSIAETVNTTDNPSSFSSPPFFLIPLKDLLALLISL

>SSO11108 43 aa !not a gene!
ATGACTAATGATGCTTCCAGTCCTTCAATCGCAGAAACTGTAAATACCACAGATAATCCCTCTTCCTTTTCTTCTCCTCC
CTTCTTCTTAATCCCTTTAAAAGATCTCCTTGCACTCCTTATCAGTCTA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2528613 - 2529741 (Additional range around SSO11108 is :500nt.)

>Sulfolobus solfataricus P2 TAACGGGGAAGTTAGGCAAGACGCTTACGCTGAGGACATGATATTTAAGATTGATGAGATAATCGAGTATTTGTCAAATG GTATAACATTAAAACCTGGAGATATAATATCTACTGGAACTCCGCCTGGAGTTGGATTAGCTACTGGAAAATTCTTGAAA CCGGGCGATACAATTGAGGCGGAGATAAGCAAGATAGGAGTGTTAAGGAATTATTTAGTAAAAGAAGAATAAAATTATTA AATCTTTATTATAACGTAATTTATTCCCAAATAGGCTAGGAAGAATAATGGTAGTATAAGATCTGGTATGTCAAAGACAA CTTCACTTATCCATAAGGTACCTAAGCTAAAGAGTAACGCAGAGAGAACGAATTTCAAATGAGGTAATCTAATTCTAGCC ACTTGCGATTTTAGTATTGCCGTTAAGATAACCACTAAAACTGAAGCTAGTATTGCACCCATTACTGCTGATGAATAACT TTGAGGTATAAGGGCTAAA ATGACTAATGATGCTTCCAGTCCTTCAATCGCAGAAACTGTAAATACCACAGATAATCCC TCTTCCTTTTCTTCTCCTCCCTTCTTCTTAATCCCTTTAAAAGATCTCCTTGCACTCCTTATCAGTCTA TAACCAAAAT AGAATAGAATCACCGCTGATGCTAAAAGTACGTAATTTAAGGGAACCAAATAAATTAACTTACCTAAAGTAAACGTTGGT ATGAGAACGATAGCAACACCCAATACGGCGTAAATAAATGGTAAATTGTTCTTGTAAATATTATGATATATTGCAGCTAT TGCACCAGCTTCAGTTAGTTCAAGAAGGGATATTCCTAATGCGGCAAGGAATACACTCACATCCATAATCCGAATTATGA AAGTAAGTTAATAAAACTATAACTCAACCTTTTATCCTCTCCCATTTGCCTTTGAATAGGACGTACTTACCTTCCTTAGC TATCACCTTTCCCTTCCTTATCACAAATCTAGGAGGCCACATGAAACGAATCAAATCTATAACGTCATCAGCATCAGTTA CTAGCAAATTCGCCTCATTACCAACTTCAATCCCATAGTTCTTTACTCTCCAAGCTTTAGCTCCATTAAAAGTTATCAAG TTGATTGAGG