SSO11112

Coordinates:2532622-2532777

>SSO11112 52 aa !not a gene!
MINSIMNNLYPILFSLQPLHQIPFSGVRNCNNTLIIAYTPLRKSYSPSHDWV

>SSO11112 52 aa !not a gene!
ATGATCAATTCCATTATGAATAACCTCTATCCTATCCTCTTTAGCCTTCAGCCTCTCCACCAAATCCCTTTTAGTGGTGT
TAGAAACTGCAATAATACTCTTATAATTGCTTACACTCCGCTCAGAAAAAGCTACAGCCCTAGCCATGATTGGGTT


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2532122 - 2533277 (Additional range around SSO11112 is :500nt.)

>Sulfolobus solfataricus P2 CTCTTGTCCCAATCATAATTTAAAGACTCTTCATAACTACTTTTCCATAGTTCCTTAATCCTTTTCTCATCCTCTATTAA CTCATTTATGATCTTACTCATCGCTTCAATATCCTTATAATTTACTATATACCCATTTACACCATTCTTTATGATTTCCG GCAAAGATCCCTTATTATAGGCAATTACCGGGGTTCCACATGCATTAGCCTCGACTGTAACCATACTCCAACCCTCTATG AATGAGGTTACTATTACAATCCACGCTGACTGATATAGTCTTATCTTATCCTCCTCACTAACCCTCCCAAGATATTCACC ATTAATAGTCTTGATTTTCTGCACTACTTCATTTTCTAGATCTCCTCCCCCAGCCATAACCAGTTTAGCCTTGACTCTCT TAGCAACGTCGATTGCATCTAATGGGTTCTTATATTTCTTTAATCTTCCTATCCAAAGTATAGTTGGCTCGCTTGCTTTC TTGCCCGGTCTGTAAATGTT ATGATCAATTCCATTATGAATAACCTCTATCCTATCCTCTTTAGCCTTCAGCCTCTCCA CCAAATCCCTTTTAGTGGTGTTAGAAACTGCAATAATACTCTTATAATTGCTTACACTCCGCTCAGAAAAAGCTACAGCC CTAGCCATGATTGGGTT TAACTCGTATTTTACTACATCTTGATGGACGTGATGGACTAATGCAATTGCATTCTTATTTA CTAGATATGAATAGAACGGTACAGCATGGGCAACACTGTCAATTACAATCTCATGTCTCCTTGCTTCTATTGGTGCATAA AGATGTAAGGTAATTGAATTTCCTCTCCTTATTATTCTGATATTTTCAATTTCCTCCTCCTTAGGTAATCCCTTTATCTC TTCAGAAAGCCACGTCACGCTAACTCCTTTCTTAACCAATCTCCTAGATATCTCGTAAATTACTTGTTCAGCTCCTCCAG CCTTCCTGTGCCTTAGATCTCTGTGATTAGTTATTAATAAATCCACATTTGAAAATCAAAAACCTATCCATATTTATAGC TTATACCTCCTTCTGGGAAATGAAACTTTATTGCACCATATGGGCAAGCTACTAATGCCGCACCGCATTCTAAGCATCTC TCATAGTGTACCACAATTCTTCCATCGGGAGAAGGCT