SSO11121

Coordinates:2535859-2536011

>SSO11121 51 aa !not a gene!
MILNCDNFILTDTLSGALYLVHIEVTEPKKPYYTIIYQFLKCPYSLANRYS

>SSO11121 51 aa !not a gene!
GTGATTTTGAATTGCGACAATTTCATACTTACTGACACACTCTCTGGCGCTCTCTATTTGGTCCACATCGAAGTTACTGA
GCCCAAAAAACCTTATTACACCATCATCTACCAGTTTCTCAAATGCCCTTATAGTCTTGCAAATCGGTACTCT


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2535359 - 2536511 (Additional range around SSO11121 is :500nt.)

>Sulfolobus solfataricus P2 AAAGCCTAGCGGAAAACTTGCTAGCTAATTCTATCGCAAAATCTAAAGCCCTTTCTGCGTTTTCCGAACCATCATAACCT ACTAAGATTCTCTTCATAGATACTTATTTGATTATATAATTTTAAAATTAACTAAGACCAAGGTCTCATCGATTTCAAAG ACGATACAAACTTATCTAGAAAATAACTCTTCTCTCTAAAATGCTCATCTATTGCCCTCCAATCCTCTTCTGACAATCTC CAACCCATTGCACCAGCATTTTCCTCTATATGGGGTATTTTAGAGGCTTTCACTATTGGTATCAAACTGTTTTTACCAGT AATATACCAATTTAAGGCTACTTGAGTTGCAGTCTTATTGTACTTCTTACCTATATTAGCTAAGAACTCATTCCTAGCTA ATATTCCATTTTCCAATGGTGTATACGCCATATACATCAGTCCATTTTTCTCCGCGTAAGCTAAAGCCCTCCTCTCATCA CTTCTACTTAGCAAACTATA GTGATTTTGAATTGCGACAATTTCATACTTACTGACACACTCTCTGGCGCTCTCTATTT GGTCCACATCGAAGTTACTGAGCCCAAAAAACCTTATTACACCATCATCTACCAGTTTCTCAAATGCCCTTATAGTCTTG CAAATCGGTACTCT TGATGGAGCGTGAAGTAAATAAAGATCTATGTATGTGCCTAGTCTTCTTGAACTATTTTTAGCTG ACTTTATTACATTATCATAGTCAGCATGACTAGGCCAAACCTTAGACACTATAAACAATTCTTCTCTGCTAAATTCCTTG ATCGCTTCACCTACCAATTCCTCAGCGTGACCATTACCGTACATTTCAGCAGTGTCGATAACTCTTAGTCCTAGTTCTAT TGCCCTACGAATCGCACCTACCCATTCATTGTCTCTGTCATGAGAGGAGTACCAATAACCTCCCCCAATCCTCCAGGTTC CAAAAGCTAGAGGTGATACTGTAAAGTATTTAAATTTCTTAACGTCTTCCATAAATATACCTTAAATTCGTTCCTTTTAA AAATTGTCTTCTAATGCATATCTTGTCTATACTTTCTGAGACTTTAAAGGACAAACTCTCTTCCTAATATACGGAAAGGT CTTTATGTAATTTTGGAAACGTTGTTGCCCTTTA