SSO11124

Coordinates:2537096-2537284

>SSO11124 63 aa !not a gene!
MMNPILMTGYAHEVLGATNTDGRVVVFPSTSPNELRVSVYEPSRGVPVAELEVVKSKQKLRHG

>SSO11124 63 aa !not a gene!
TTGATGAACCCCATACTGATGACGGGCTATGCTCACGAGGTATTGGGGGCGACAAATACGGATGGGAGGGTAGTGGTGTT
TCCCTCGACTAGCCCCAATGAGTTGAGGGTGAGTGTGTATGAGCCCTCAAGAGGGGTGCCCGTGGCGGAATTAGAAGTAG
TTAAAAGTAAGCAGAAGTTACGCCACGGG


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2536596 - 2537784 (Additional range around SSO11124 is :500nt.)

>Sulfolobus solfataricus P2 TTTAACTGACTATCAAGTGGTGATGAAGAGGAAGTGATTCAAGTCTCCTTTGCGAATTGCAATTTGTAAATAATACTGTT GTAAAAATGTTAATATTGGTAGTCATGCATCTCCGCCAGTTAGTCGTCTTCAATTAGTTAATTTCGTAGTAATCTTTAAA ATAAACTGAATTCACAATGGCTAACTGAATCTCCCTAAAAAGCTTCTAATGTAGTGTTATCGGGAGGCTATAGATAAAAA TCCGAAAAATAATAATTACGCACTAATTTTAAAATTTTCCAGTACAGTATTATAGTAGGAAAATGGAAATTTCTAATTAA GTAGGTTTCCCTATATTATGATATTCCACTGGTGTGAGCAAGCTGTTAATAGAAGTAGAAGGATGATGGACTACTGTTTA GACTGTAACACATTTGCATAACTTTTAAATACTTTTAATCATTTCACAATATGATCTTTATTATGATTATGTTTATATAT TATTTCCTCTACATTATAAA TTGATGAACCCCATACTGATGACGGGCTATGCTCACGAGGTATTGGGGGCGACAAATAC GGATGGGAGGGTAGTGGTGTTTCCCTCGACTAGCCCCAATGAGTTGAGGGTGAGTGTGTATGAGCCCTCAAGAGGGGTGC CCGTGGCGGAATTAGAAGTAGTTAAAAGTAAGCAGAAGTTACGCCACGGG TAAACACTCGCTAAATGTAATGTATCTTT ACTTCAAGAAAGGAAACACATTTGTATAGTAGCTTCTGATTTTTTAAGAAGATTTTACTTATTCCTTTTCTCTTCATATA ACTTCTTTGCATATTCCAATATTTCCTCAGCAATTTTAATTGATTGTTGACCATCATAAGCTGAATAGAGTAGTTCAGGA GGAGTATTAGTTTCTTCATCACCATACATTGATAGTTCCCTTTCTTTCCTTAGGGATCTCGAGTATGAGGCAAAAATATC TATCTTTTCTTTAAACCATTGTGGAAATTTGTCTGTATTATTTTTTAATATTGGACCTACATCATGAAATTTGGGTGGTT CTATATTAACCAATCTAAGACATGCTTTAAGAGAGAGCTCTACAGCTTCTTGACAAAGTCTTACTACAATGTTATATTTC TTTCTTTCATATTCTGTTTTAGCTAAATCTAATCTTTCTTCAGCTTGTGTAATATATGAAAATGCTAAGG