SSO11129

Coordinates:2538868-2538996

>SSO11129 43 aa !not a gene!
MNPGPLPYQGSALARLSYRGIINIKKTRIIKVFLTYQLLRSVS

>SSO11129 43 aa !not a gene!
TTGAACCCGGGACCTCTGCCTTACCAGGGCAGCGCTCTGGCCAGGCTGAGCTACCGCGGCATCATAAACATAAAGAAAAC
AAGGATTATAAAAGTATTTCTGACTTATCAGCTATTGAGGAGTGTTTCT


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2538368 - 2539496 (Additional range around SSO11129 is :500nt.)

>Sulfolobus solfataricus P2 AGCTTCGTAGTAACGGTCAGCTATTTGTTGAACTACTTGCGAGTAGACTTGCTTATACTCATCATCTTGTTTTCTCAGAT CTAGAGCCAACTGTCTTAACTCAGTTTGTGTTAGTCCTTTCCCATCCCTTTGGTAAAAGTATATGTCTGCCCACCTTAAG GTGTTGTAGATTTCGCACGCTAACTTCAACTGGGCCTTTAACGCCCTAAGGGTTTGTTCGTCAGTGTATGCACGGAAGCG AAACCCTAAGGTGGGTATTGATGTGTATTTCGTTATTTTCCTATTTTTAACTTTTCTACAAAGGGATTCATCTCAAAGAG AAGTTTTCCGCCCCCTTTGAACCCCCGTCTGTTATAAATGAAATCTCCCACTGATATGTAAAAATTCTTTTATAACTAGC TATTTATCTCTTACCAGTGAGATTATTCGCCACCCAAAAACTAGTAGAGATAAATTTTGTGGCTATCCTTTCTTTAGTAA CAAGAGCCGCGGCCGGGAT TTGAACCCGGGACCTCTGCCTTACCAGGGCAGCGCTCTGGCCAGGCTGAGCTACCGCGGC ATCATAAACATAAAGAAAACAAGGATTATAAAAGTATTTCTGACTTATCAGCTATTGAGGAGTGTTTCT TAATCTATAG TATTTTTAGGTAAAGTTATCTTGAATGCCTTTTGCCTTAAATGTTTACGTAGATTCTCTTCAAGAAGATTCTAATAATTA TAAATATTAAAAGGGTATAGTCTAAATATTATATATCCTAAATGGAACAAACTTTTAACATCATTTATTAGGGATCATTT TCAGAAAACTACTATTATCTATTTTAGAATTAGCCTAATTCATAGAGAATATTACAATTCGCAATGGAAACATGAATCGC CCACAGATAATTTTGAATTTGAGATAAATCATATAGATTAATATCGAGAAAAATTTAAGGGTTAGGCGAAATAAAAAGGA AAAGTGAATTTATAACTATAGGACAATTCAAGTCTCCTTTGCGAATTGCAATTTGTAAATAATACTGTTGTAAAAATGTT AATATTGGTAGTCATGCATCTCCGCCAGTTAGTCGTCTTCAATTAGTTAATTTCGTAGTAATCTTTAAAATAAACTGAAT TCACAATGGC