SSO11147

Coordinates:2544797-2544922

>SSO11147 42 aa !not a gene!
MDGRILEVANNRILRKFRKQLNNRMPMPVISVRTIRNSQHVY

>SSO11147 42 aa !not a gene!
TTGGATGGCCGTATTTTGGAAGTAGCGAATAATAGAATATTAAGGAAATTCCGGAAACAATTAAATAACCGAATGCCAAT
GCCAGTAATATCTGTACGTACGATTCGTAACTCACAGCATGTATAT


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2544297 - 2545422 (Additional range around SSO11147 is :500nt.)

>Sulfolobus solfataricus P2 AAGTGAACAAAATTGTTGTTCACCCTCACCAAAATCTTGTTAATCTTAAGGTTTGATAAGTGGGAGACTTTTTTATGGTT AAGCTTCTGGATTACTGGTTAGTTTCTTATCTAATGGGTTTAAAGGGTTCTTTTATTGAGGTTTTTGTTGTTGCTCCGTT TGTTTTAAATAAATTTTATTCCCTATAATCATATTATTAGGTATTAAGACTCTAGTGCCGTCAGCTTTAAGTATTGTAGT AAACAATGTACTGACATCTTCGACAATACCATCTTCGCTAACTATGTTAACGTTATCATTTACTTTAAATGGCCTAGCTA CTAGTAAGAACAACCCAGCAACTGCTTGACCTAGTACTTGCTGTGATGCGAACCCTATTACTATGCCTATAAACCCTCCT AATGCAACACCGGCCGCTCCTCCAGCAACAGCACCAGCTATACTTGCAGCTAACGCGCCAATTCCAATAATTCTCATTAT GTTTCTCACTGCAGCAGCAG TTGGATGGCCGTATTTTGGAAGTAGCGAATAATAGAATATTAAGGAAATTCCGGAAACA ATTAAATAACCGAATGCCAATGCCAGTAATATCTGTACGTACGATTCGTAACTCACAGCATGTATAT TGAATGATGGTA GCAACGATTCAATTATATATTTAACTATTGCACTCAAAATAACGTAAAGGATTATATAGATTATTGTTCTTACTATTGCA TTTCCGACCTTTGTGGTAGTAGATTTCGCCATATTTCTCTCACCTCATTATAAGATAATAAATATAAGATAAGATATAAA AAATTTTTTATACTAAAGACTAGCTTTAGTTAGACATAAATTGCAAATAATTTATATTTATTTTCGCTTCCAAAATATTC TCCATAAAATATAAATTACGATTATTACAATTACAAGTATAAATAAATAATTCCCTAATTTCTCTGCTTGGGTTATGACA AAGTTAATTTGATTGGCCAATTGATAGCCTATTAATGCAAGTACTATATCCCAAATAGTATGTCCTAAAAATGTAAATCC TAAGAACTTCAAAATTTTCATTTGCCCTATACCTGCAGGATATGATATTAAGGCCCTTAACCCCGGGATAAACCTAAATC CAAATAC