SSO11149

Coordinates:2546129-2546305

>SSO11149 59 aa !not a gene!
MNFVKELKISKEEIEDYLNYYLDKETNLTKTDYVLMSLLIGEIFWSGDSKKLSEKRSQS

>SSO11149 59 aa !not a gene!
TTGAATTTTGTAAAAGAACTTAAGATTAGTAAAGAGGAAATAGAGGATTATCTAAATTATTATTTAGATAAAGAAACTAA
CCTAACGAAGACAGATTATGTGTTAATGTCACTTCTTATCGGTGAGATCTTTTGGAGTGGAGATTCGAAGAAACTTTCCG
AAAAGCGATCACAATCA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2545629 - 2546805 (Additional range around SSO11149 is :500nt.)

>Sulfolobus solfataricus P2 AACCAACGGCATTATAACCTCACTAGGTAAAGGTAACCCTATACCTTCACCTATCATGAGGAGAAACAATATTATGTAAC CTCCTATACCTTGAAATACATATACCATTATGAGTAAGCTTTACCCTCTACCTTAAATAGTTTTCCGAGACGTCATGATG TTAAGATCACTTCTGTCCCAAAGGTTCCTCACACTACCGTAAATCCTCTCAATCTTATCAACTAGGGTGGGACAGTTTAG TCGCAAATGTCCTTCCATAGCACAATACTATACTAAGGGTAAAAAATCAATAGAAATTTTTATTGGATATGACTGATTTA TTCTAAGATATGATTAGACTACTTGTAAAGCTTTATACTATGATTTAATAGCATATCTTATGAGAGTACAAGTTAAGGGA AATTACGTTTACGTAACATTCATTATGGGATAAGCAACTGAAAAGACCAAGAAGATTTTATCCAGGTATAGCGGAAAATG TAGAAATATATAAAGAGCTG TTGAATTTTGTAAAAGAACTTAAGATTAGTAAAGAGGAAATAGAGGATTATCTAAATTA TTATTTAGATAAAGAAACTAACCTAACGAAGACAGATTATGTGTTAATGTCACTTCTTATCGGTGAGATCTTTTGGAGTG GAGATTCGAAGAAACTTTCCGAAAAGCGATCACAATCA TAAGAAGGTTTTATCCAGATTATGCATTGATAGGTAGATAT GCTAGGAATTTCTATGCTCCTCCAGAAACAACTTTAGACATCGATTTTTTAGTTAACGTAGATGATATAGAGATACTTGC AGAGCTAATCGATTATGTAAGGTCTCAAGGTTATGAGATACATCCAGATGATATAGGTCCCTGGCAATACAAGATAGTAA TTAAGGGTATAAGAGTTGATCTAGTTAAACCTAAAGGGATAGATATAGATAACGAGATGATCTCTAAAAGGAGGGTCGTA GAATTAGTGAACTTTATATCATTTCTCCGGAGGATTTGGCTGTTCTTTATGTCGTTTCCTCCCTGAGAAGTTAGAGACTT AATAAAAACTAAGGATATTATTGTATATTCCATTTGGAGAAGGGATTTCAACGTAGACTACTTTTTAAAGAAGTGTGAAA AGAATAAAGTAAAACCATCTGCTTAGAATTAATTAAATGGATAATATATCTATGAGCA