SSO11160

Coordinates:2550127-2550246

>SSO11160 40 aa !not a gene!
MTSPNAYSAQYALIWIYFYVINSRDCIVLIQFNLLRHLLN

>SSO11160 40 aa !not a gene!
TTGACAAGCCCTAACGCATACTCCGCACAGTACGCACTTATTTGGATCTACTTCTACGTTATAAACTCCAGGGACTGTAT
CGTCCTCATTCAATTTAACCTTCTTCGACATCTCCTCAAT


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2549627 - 2550746 (Additional range around SSO11160 is :500nt.)

>Sulfolobus solfataricus P2 TAAATTTAGATATGTCGAAATCGTTGATTACAGTCTTCAATAGATCCTTAGGCGGATAGTATCTTACATTCGAGAGCGAT GAAGTAAGTAGTCTATAGATTTCAATAGAGGAAAGATCAAAAATCGCGTCTAAGTCAATAACGTACGGTATCATTTTTCC CACTTAACAGTCTCTCTAGCCAGATCTTAGTTAATATCTTTTGCTTACACTCATTACAAACATCGGTATATTGTGCAGTT CCAGCAAATCCATATTGTATCAGTAGTGTATCAACCTTGTTCTTAATTCTCTCTGAACCCAATGGCTTTCCACAGAATCT ACATTTACTCACATTTGCCTTATTAACAATTTTCCTCTTAAGGTCAGAAATCTTAGCGTAACCAGTCACGATTACAGCTT TTTCTGGGCAGTTCTTAACACATCGTTGAGAGCCTATGCAATAAGGTATATTATAGCTTAACTCTAATGTGCTACTACCC TTTAGTTCAGGAACTAACAT TTGACAAGCCCTAACGCATACTCCGCACAGTACGCACTTATTTGGATCTACTTCTACGT TATAAACTCCAGGGACTGTATCGTCCTCATTCAATTTAACCTTCTTCGACATCTCCTCAAT TGACCATATTAGAAGTGC CCTTCTCCTACTACGCTGCAAAATAACTTCGAGTGGTATTTCAGATCTACTAAGCTGTATTGGCTTAATATAGGACAGTG TTTTTTTAAGCTCCTCGTCATTTCTAACCTTACTAATGATGAAATTAGTACCGGGAAAATGGGATGGTAATTCGTCTAGT CTCTTCAATGCGATATCCCTACTTTCGCATTTAGAGGATACGTGAACTATGGGAGTTATCCCTGCAGCATATGAGGCTAG AACAAATGAGTCGTGAACCCCTGCAGTACAAGGCATTAAGAATGGGAATATGCCTTCTGGTATATCGTCAATTATCGAAT CTGTGAATAGTATTGCTGCTTGTTTATCCCTATAGTGTCTAACTATAGTATTAATGAAACTTAAAACTTGATCCGTAGTT GCTGTTGGAATTTCAAGATATCCTAAATATGAGCTCGCGGAGCAATATCCACATACACTGCACTTCTCTGGATAACCTAC T