SSO11162

Coordinates:2552387-2552656

>SSO11162 90 aa !not a gene!
MFRLWRLSDVMQGMEHIGDVWTITRPKSIRRIRRYVLAKSTLCRSRNISPDKGLQYTNKLLPLYKRTLYRSLPSRCYIQE
NRGWYSISRL

>SSO11162 90 aa !not a gene!
GTGTTTCGGCTGTGGAGGCTGTCAGATGTCATGCAAGGAATGGAACACATCGGGGATGTTTGGACCATTACCAGACCTAA
ATCCATACGGAGAATTAGACGTTATGTTCTGGCTAAGAGTACTCTATGTAGAAGTAGGAACATATCCCCAGACAAAGGTC
TACAATATACCAATAAACTGCTTCCACTGTATAAACGCACCTTGTACAGAAGTTTGCCCAGTAGGTGCTACATTCAAGAG
AACAGAGGATGGTATAGTATTAGTCGACTA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2551887 - 2553156 (Additional range around SSO11162 is :500nt.)

>Sulfolobus solfataricus P2 ATTGTATCTTGATCCAATCACTGGACAAACTTCATGGCATGATAGCAGAATAAGAATTGTAGGTAAAAGTACATCATCCC AAGTTCAAGTAGTCTCCAATAAGTTCACTTACATGGGTCAGGACTTTTCAAACCAAGATATACTTAGCGTAATAGTAAGC AAAATGGGAGGTCAAATAACAGTAAATAATACACCATCGCAACCAACATTTGCACAACCGGTCGATATTCCACATTTAAG ATTCGACGCTAATAACATTACGTCAACTAGCCTATGGAGTTATGTTGCACCTGGTTCGTTAGCCCCAACTTATACTATAG GGCAATATAAGATAAGGTATGGGTTCGCAACAGAACCCTCCTCTTAAGGTGATAAATATGTCTTCTCCCCAAAATACAAC CACACCACAAATTAAATTAGATATAAGACAAGGTGGTGTTCAACACGCTCCACCGTTTAGCTTAAAGGCAAACTACGCCA TAATTACTGATTTAAACAA GTGTTTCGGCTGTGGAGGCTGTCAGATGTCATGCAAGGAATGGAACACATCGGGGATGTT TGGACCATTACCAGACCTAAATCCATACGGAGAATTAGACGTTATGTTCTGGCTAAGAGTACTCTATGTAGAAGTAGGAA CATATCCCCAGACAAAGGTCTACAATATACCAATAAACTGCTTCCACTGTATAAACGCACCTTGTACAGAAGTTTGCCCA GTAGGTGCTACATTCAAGAGAACAGAGGATGGTATAGTATTAGTCGACTA TAACGAATGCATAGGGACTAAGTACTGTA TTTACGCATGCCCATACGGGAATAGATTCTTCGATTACGTAGAAGGAGTTACAAAGAAGTGCACCCATTGTTTCGATAGG ATTTATGATCCTACATTACCCCCAGAGGAGAGGATACCGGCGTGTATCCACGGATGTATGGTTCAAGCTAGAATTTGGGC TAATATCTTAGACCCAACTGACCCTGGTACAATTTTATTCTATGATAAAGGAGGATTTGTAATGGGACCAGAAACTGGAG CACAGCCAGCAAGTGGTTATTTGCCATGGCGTAGCAAATACGCTGAAAGTGATGTCCAATTGTTAAGTGAAGCTGAGTAC TACAACGTATGGACTGCTAATGGTGTAGTGCAACTCGGCGCCCAGGGGAACAACTCTACCTATACAGAAGGGAATGGATC AAATTCCAGCTCAAATTCATAATTTTTTTAAAAAAAAATGGTGATTTATATTGGCACTCTCTGTTTTGTTA