SSO11166

Coordinates:2554450-2554659

>SSO11166 70 aa !not a gene!
MGSSWGQLYFDLDMLSISIVMLIEYRQYLILDIMRVMQASSMNQKDLEVMKLVYQRYCGNRILQGMINLA

>SSO11166 70 aa !not a gene!
ATGGGTTCTTCATGGGGTCAATTGTATTTTGACTTGGATATGCTCTCAATATCCATAGTAATGTTAATAGAGTATCGCCA
GTACTTAATACTGGATATAATGAGGGTAATGCAGGCCAGTTCAATGAATCAGAAGGACCTTGAGGTAATGAAGTTGGTCT
ATCAAAGGTACTGTGGAAACCGTATACTTCAAGGAATGATAAATCTGGCA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2553950 - 2555159 (Additional range around SSO11166 is :500nt.)

>Sulfolobus solfataricus P2 TCCTTTTCCTACTTTAACATAACCAGGGTTGATATCGTCTAGTGTCATTTTTCCCGCAGCGTATTTATTGATTATGGTCT GTAACATTGATTGCAACTTAGGTTGAAACTCTACTGAAATCCTAAAGTAATGTTCTACTCCACTTGATCTATTGCTAGCA CTATTCTTGTAAGTTGGAGCAGTAGAGAATTTTTGCCCACTGGGTACACTACTTAGTATCTGATTTATTACCGCATCTTG TGTTGAATTGTTTGGTACGGATGATGCATAAAGCTTTAATTGTTGAGGATTAGGCGATTGTTTACCATTAGCATCTGTCA AAATGTACTGGAATCTATCACCATAACCTGCCAACAATATTCCTTGTTTTAATATAAACATTCCAGTGGATATTAATCCA GGCTGACCTTGTTGTAGAATTGCAGTTCCAGTGAGTGGATCATGTAACGTTATAGGGCTAATCAAGTCTCCACCAGTTAT AGGATCTTGAGTAGTATAGA ATGGGTTCTTCATGGGGTCAATTGTATTTTGACTTGGATATGCTCTCAATATCCATAGT AATGTTAATAGAGTATCGCCAGTACTTAATACTGGATATAATGAGGGTAATGCAGGCCAGTTCAATGAATCAGAAGGACC TTGAGGTAATGAAGTTGGTCTATCAAAGGTACTGTGGAAACCGTATACTTCAAGGAATGATAAATCTGGCA TAATTAGA TCAACTACATTATTAGTTTCATGCATGAATAAGTCGAATGAGATTGTAAATGGAATAATGTAATTCCCACTGCTATCTTT TTCAGTTACCATTTGAAGTACTTCTGCAAGGTTATATGCGTTATTCCAGAATGGTGATGTTATGTACCACATCATGGCAT TTATTGTGTATGGTATAACTTGCTTTGGATACTTGTTCATAAGATATGAGGTAGCCGCTACAGCTGAAATCGACCTCTGC GTTGTTAGTGGTAGTTCCCAAGAATAACCTCTGTCTACTAATAATGGCCTTCCAGTTTTATATATTACTAAATCATCTGG GCCATCGGGGAACCCATAGGGTCCAGCGCCTACAACTTGTACATTCTTTACATATACTGTTCCATCATTGTATATGTATT CAGTTTTTAAGAACCCACTCCTACTTTTGGGTATCGTTAGATTTAGCCCTTGTATTGCGTTTGCTACATCTGGATCTATT TGCGGAGCATT