SSO11167

Coordinates:2554809-2554931

>SSO11167 41 aa !not a gene!
MYHIMAFIVYGITCFGYLFIRYEVAATAEIDLCVVSGSSQE

>SSO11167 41 aa !not a gene!
ATGTACCACATCATGGCATTTATTGTGTATGGTATAACTTGCTTTGGATACTTGTTCATAAGATATGAGGTAGCCGCTAC
AGCTGAAATCGACCTCTGCGTTGTTAGTGGTAGTTCCCAAGAA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2554309 - 2555431 (Additional range around SSO11167 is :500nt.)

>Sulfolobus solfataricus P2 TTCCTTGTTTTAATATAAACATTCCAGTGGATATTAATCCAGGCTGACCTTGTTGTAGAATTGCAGTTCCAGTGAGTGGA TCATGTAACGTTATAGGGCTAATCAAGTCTCCACCAGTTATAGGATCTTGAGTAGTATAGAATGGGTTCTTCATGGGGTC AATTGTATTTTGACTTGGATATGCTCTCAATATCCATAGTAATGTTAATAGAGTATCGCCAGTACTTAATACTGGATATA ATGAGGGTAATGCAGGCCAGTTCAATGAATCAGAAGGACCTTGAGGTAATGAAGTTGGTCTATCAAAGGTACTGTGGAAA CCGTATACTTCAAGGAATGATAAATCTGGCATAATTAGATCAACTACATTATTAGTTTCATGCATGAATAAGTCGAATGA GATTGTAAATGGAATAATGTAATTCCCACTGCTATCTTTTTCAGTTACCATTTGAAGTACTTCTGCAAGGTTATATGCGT TATTCCAGAATGGTGATGTT ATGTACCACATCATGGCATTTATTGTGTATGGTATAACTTGCTTTGGATACTTGTTCAT AAGATATGAGGTAGCCGCTACAGCTGAAATCGACCTCTGCGTTGTTAGTGGTAGTTCCCAAGAA TAACCTCTGTCTACT AATAATGGCCTTCCAGTTTTATATATTACTAAATCATCTGGGCCATCGGGGAACCCATAGGGTCCAGCGCCTACAACTTG TACATTCTTTACATATACTGTTCCATCATTGTATATGTATTCAGTTTTTAAGAACCCACTCCTACTTTTGGGTATCGTTA GATTTAGCCCTTGTATTGCGTTTGCTACATCTGGATCTATTTGCGGAGCATTAGCTAATGGATGTGGTGGTACTGCGTGA CCGGGGAGGTAGTGCGGATAAGGATATTTGTACAGATCAGCACCTGGGTTGTCCCACGCACCTACCATTAATACTAGATA ATAGAGCGATGCGGCACTCATAAAACCATTTGCATGGGCAGCTAAACCTCTCATGAAGTAAATGGAAACTGGCCTACCTA CCACGTGGTCGTGGAATCTACCTAAATAATCTACCCACTTAGCTGGTTCGTATATTGCCTTTTGGAAAGCTACATTAGCA ATCT