SSO11169

Coordinates:2554791-2554928

>SSO11169 46 aa !not a gene!
MGTTTNNAEVDFSCSGYLISYEQVSKASYTIHNKCHDVVHNITILE

>SSO11169 46 aa !not a gene!
TTGGGAACTACCACTAACAACGCAGAGGTCGATTTCAGCTGTAGCGGCTACCTCATATCTTATGAACAAGTATCCAAAGC
AAGTTATACCATACACAATAAATGCCATGATGTGGTACATAACATCACCATTCTGGAA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2554291 - 2555428 (Additional range around SSO11169 is :500nt.)

>Sulfolobus solfataricus P2 TTGCTAATGTAGCTTTCCAAAAGGCAATATACGAACCAGCTAAGTGGGTAGATTATTTAGGTAGATTCCACGACCACGTG GTAGGTAGGCCAGTTTCCATTTACTTCATGAGAGGTTTAGCTGCCCATGCAAATGGTTTTATGAGTGCCGCATCGCTCTA TTATCTAGTATTAATGGTAGGTGCGTGGGACAACCCAGGTGCTGATCTGTACAAATATCCTTATCCGCACTACCTCCCCG GTCACGCAGTACCACCACATCCATTAGCTAATGCTCCGCAAATAGATCCAGATGTAGCAAACGCAATACAAGGGCTAAAT CTAACGATACCCAAAAGTAGGAGTGGGTTCTTAAAAACTGAATACATATACAATGATGGAACAGTATATGTAAAGAATGT ACAAGTTGTAGGCGCTGGACCCTATGGGTTCCCCGATGGCCCAGATGATTTAGTAATATATAAAACTGGAAGGCCATTAT TAGTAGACAGAGGTTATTC TTGGGAACTACCACTAACAACGCAGAGGTCGATTTCAGCTGTAGCGGCTACCTCATATCT TATGAACAAGTATCCAAAGCAAGTTATACCATACACAATAAATGCCATGATGTGGTACATAACATCACCATTCTGGAA T AACGCATATAACCTTGCAGAAGTACTTCAAATGGTAACTGAAAAAGATAGCAGTGGGAATTACATTATTCCATTTACAAT CTCATTCGACTTATTCATGCATGAAACTAATAATGTAGTTGATCTAATTATGCCAGATTTATCATTCCTTGAAGTATACG GTTTCCACAGTACCTTTGATAGACCAACTTCATTACCTCAAGGTCCTTCTGATTCATTGAACTGGCCTGCATTACCCTCA TTATATCCAGTATTAAGTACTGGCGATACTCTATTAACATTACTATGGATATTGAGAGCATATCCAAGTCAAAATACAAT TGACCCCATGAAGAACCCATTCTATACTACTCAAGATCCTATAACTGGTGGAGACTTGATTAGCCCTATAACGTTACATG ATCCACTCACTGGAACTGCAATTCTACAACAAGGTCAGCCTGGATTAATATCCACTGGAATGTTTATATTAAAACAAGGA ATATTGTTGGCAGGTTATG