SSO11174

Coordinates:2556445-2556564

>SSO11174 40 aa !not a gene!
MNRNHRGLLHLLYRSLLRNTHLLYQVLIDPFLPKRLKHED

>SSO11174 40 aa !not a gene!
TTGAACAGAAACCACCGTGGGCTGCTGCATTTGCTGTACCGAAGTTTGCTGAGAAATACCCACCTGTTATACCAGGTATT
AATTGATCCCTTCCTTCCCAAAAGGCTAAAGCATGAGGAT


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2555945 - 2557064 (Additional range around SSO11174 is :500nt.)

>Sulfolobus solfataricus P2 AGTGTAATACCTTAAGAATTCCTCATCTATATGAGCATATACTGCCGTGGAAGGAATATCACCTAAACTTGATAGAGCTA CTACTTGACCAGATGGGGTTATTGTTTGCATCCATAATTGACCAGATGCTGGATTAACTGCAAGTTGGACTGGCTGTAAC GTTATTGGGTTAAGTACTTTTTGTCCTTGAGAAACCTTATATATGTAGTAGTGGAAGTCAACTAGTACTCTGATCCAACC CATTACTAGTGCTCCATCTGTTGCTGGGTTAACGAATAGATGTTCATCAGAAACTGAATAAAATCCATACCTCTCCGGGG CTATCGTTAGTACCTTTCCACCATTCTCCCTTATTCTAGCAATTATCCTTCTCATCCAATTGGGGAAGTGGTCTCCAGCT AGCCCAGCTAAAATAAAGTATTGTGATCTTTCCTCATCTGGTCCTGCATACTCCCACACTGGTGCACCTGTAACGTAAAC TCCTGCTGTATATACATTCA TTGAACAGAAACCACCGTGGGCTGCTGCATTTGCTGTACCGAAGTTTGCTGAGAAATAC CCACCTGTTATACCAGGTATTAATTGATCCCTTCCTTCCCAAAAGGCTAAAGCATGAGGAT TAGTCTCTCTAATTTTAA GCAATCCAGGGAAGTTTCCAATACCTAATTGTTGGGGATTTAATCCTAACTTACTCCAACTTTGTGCAGATGTACCATTT ACTATAATGTCAAATGCAGTATCGTAGTCTACAGCAATCCACTTTCCAGAACCCCTATCACTTGCTCTCAGTAAGGGATA CCTAAGTCTAGATGGTGCAAAATAATAGAAGACATCAGCCGCACCTCTAGGGCAAACTCCTCCATCATTTATATGCCATC CGATAGTTCCAGTCACAAACCTGGGGAAACCGGTAGGAGTTCTAACTACTTCTATTGCACATCTGCCTAAGCATTGGAAA CAATTAGTGTATACTATTTCGTCGCTAGGATAATTAAGAGTGTAATTCGTCTCAGAAACACTATCAAATATCCTCTTCGC TACACTATTTCCTCCTAAAATAAACGCAGTTGCTACAGCAGTTGCACCAGATATTTTAAGAAAGTCCCTTCTACTTAACT T