SSO11175

Coordinates:2556381-2556545

>SSO11175 55 aa !not a gene!
MGRKGSINTWYNRWVFLSKLRYSKCSSPRWFLFNECIYSRSLRYRCTSVGVCRTR

>SSO11175 55 aa !not a gene!
TTGGGAAGGAAGGGATCAATTAATACCTGGTATAACAGGTGGGTATTTCTCAGCAAACTTCGGTACAGCAAATGCAGCAG
CCCACGGTGGTTTCTGTTCAATGAATGTATATACAGCAGGAGTTTACGTTACAGGTGCACCAGTGTGGGAGTATGCAGGA
CCAGA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2555881 - 2557045 (Additional range around SSO11175 is :500nt.)

>Sulfolobus solfataricus P2 TTCTTAAAATATCTGGTGCAACTGCTGTAGCAACTGCGTTTATTTTAGGAGGAAATAGTGTAGCGAAGAGGATATTTGAT AGTGTTTCTGAGACGAATTACACTCTTAATTATCCTAGCGACGAAATAGTATACACTAATTGTTTCCAATGCTTAGGCAG ATGTGCAATAGAAGTAGTTAGAACTCCTACCGGTTTCCCCAGGTTTGTGACTGGAACTATCGGATGGCATATAAATGATG GAGGAGTTTGCCCTAGAGGTGCGGCTGATGTCTTCTATTATTTTGCACCATCTAGACTTAGGTATCCCTTACTGAGAGCA AGTGATAGGGGTTCTGGAAAGTGGATTGCTGTAGACTACGATACTGCATTTGACATTATAGTAAATGGTACATCTGCACA AAGTTGGAGTAAGTTAGGATTAAATCCCCAACAATTAGGTATTGGAAACTTCCCTGGATTGCTTAAAATTAGAGAGACTA ATCCTCATGCTTTAGCCTT TTGGGAAGGAAGGGATCAATTAATACCTGGTATAACAGGTGGGTATTTCTCAGCAAACTT CGGTACAGCAAATGCAGCAGCCCACGGTGGTTTCTGTTCAATGAATGTATATACAGCAGGAGTTTACGTTACAGGTGCAC CAGTGTGGGAGTATGCAGGACCAGA TGAGGAAAGATCACAATACTTTATTTTAGCTGGGCTAGCTGGAGACCACTTCCC CAATTGGATGAGAAGGATAATTGCTAGAATAAGGGAGAATGGTGGAAAGGTACTAACGATAGCCCCGGAGAGGTATGGAT TTTATTCAGTTTCTGATGAACATCTATTCGTTAACCCAGCAACAGATGGAGCACTAGTAATGGGTTGGATCAGAGTACTA GTTGACTTCCACTACTACATATATAAGGTTTCTCAAGGACAAAAAGTACTTAACCCAATAACGTTACAGCCAGTCCAACT TGCAGTTAATCCAGCATCTGGTCAATTATGGATGCAAACAATAACCCCATCTGGTCAAGTAGTAGCTCTATCAAGTTTAG GTGATATTCCTTCCACGGCAGTATATGCTCATATAGATGAGGAATTCTTAAGGTATTACACTAACTTATCGTGGTTAGTA ATTGTAAACCCAAATCCACAAAACGGTGATTGTCTTGATCCAACAG