SSO11186

Coordinates:2562078-2562197

>SSO11186 40 aa !not a gene!
MFQWLRLLRKFPFIKLLVMRICQTLDLQAIGAKYHGLTFH

>SSO11186 40 aa !not a gene!
ATGTTCCAATGGCTCAGACTTCTCCGCAAATTCCCGTTTATAAAGTTGTTGGTAATGCGGATTTGTCAAACCCTGGATCT
GCAAGCTATTGGAGCCAAATACCATGGATTAACATTTCAT


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2561578 - 2562697 (Additional range around SSO11186 is :500nt.)

>Sulfolobus solfataricus P2 TAAATCGTAACTCTATCTCCAACACTTACACTCTTAACATGATCTCCAACTTTTACTACCTCTCCACTAAATTCAACTCC GGGAATATGTGGTATTGGGTTCACTTTCAATCTTTCAACAGTATAATAGTCAACTGGATTTACTCCAGCTAGTTTTACTC TTATTAATACTTCATGGTTGCCTATTTCCGGGTTCTTATAGTCTGTAAACTTTAGGTTTTCTATTCCGTTCTTATCGAAT GTGAGAGCTTTCATCACCTTTAACTTGGGCTTAAAGGTTAATAAGTTAACTTTAGATTGGTAAAGATAATAAGCAAAGTT AGAAGAAAAAATATATTAAACGCATCTCGTAAGATTTAATCATAAGTCCAACGATTTATGTTTAATATCAACAATTGCTT AAGCCTTTTTGTGAGAAGATGAGTATTAAGAGAAAGTCCAAATACACATTAGGTGTTCTTCTACTTGCTTCATTTTTAGC TATTATAATGGGATTAGCAA ATGTTCCAATGGCTCAGACTTCTCCGCAAATTCCCGTTTATAAAGTTGTTGGTAATGCG GATTTGTCAAACCCTGGATCTGCAAGCTATTGGAGCCAAATACCATGGATTAACATTTCAT TAACAGCTAATATACCAA TGGCACCAACCTCTGGACTTACTCATTATCTCTTAGTTAAAGCAGTATGGAATGGATCTTGGATAATAATATTAGAAAGA TGGTACGCTCCAGAACCCGCATTTGGTGCTTGGTCGGCAGCTGCAGCTGCGCTCTATCCCCCAGCATCTGGTCCAGGTTT GTTTAGGCAAATAATGCTGACACCCGGTACTACTTATACGATAGAAAAGAATTATACTAATTATTTCTCAATAGTTAATG GAAATATTATACAAGGGAGATTAGTATTAAACTATTCCGGAATCTTGTTACCAGCTCCAAACGACACACAAATTACTGTA CTGTCTAATGGTACAATAATATTATGGCATTCCCCAAGACCAATTGAAGATCTTCTTTATTCAGATGGAATGTTTTATGG TTACTATACTAATAACACATGGTATTATCCAGATAGAGCTGCTATAATGTGGTATATGGGTAGCGTAATACCACCTACTA A