SSO11208

Coordinates:2570858-2571007

>SSO11208 50 aa !not a gene!
MPLLQFRRPHHHLELSGYHLWKVVLHSQTLGDITSCLQLSALYPYSLHFP

>SSO11208 50 aa !not a gene!
GTGCCTCTATTGCAGTTCCGCAGACCTCACCATCACCTTGAGCTAAGTGGGTATCACCTATGGAAAGTAGTGCTCCATTC
ACAAACACTGGGAGATATAACTTCGTGCCTACAGTTAAGTGCTTTATATCCATATTCCCTCCATTTTCCC


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2570358 - 2571507 (Additional range around SSO11208 is :500nt.)

>Sulfolobus solfataricus P2 GCTAACTTCAACTGGGCCTTTAACGCCCTAAGGGTTTGTTCGTCAGTGTATGCACGGAAGCGAAACCCTAAGGTGGGCAT TGATGTGTATTTCGTTATTTTCCTATTTTTAACTTTTCTACAAAGGGATCCATCTTGAAGAGGCGAAGTTTTCCGCCCCC TTTGAACCCCCGTCTGTTATAATACCTCCACGTTTACGTCGAAGACATTCTTTGGTAAATACGCTGTTACTATCCAGTTA GGTACATCAACTACCTCACTAACCCTAAGATTCACTACCACACTAGCTAATATGTAAGCCTCTACTGGAGCCATATATTT GGATAAAATGGAGATTATTCCTTTAATTGCCTTTTTTGTCGCATTCCACAAGTTAGAATCTATACCTGGGTACGCTATAT ATTCGTCATACTCCATTTCTTTTACTTTTTTCGTAACGAAAAGCGGTTGAGTTAGACCAACATTTTTAATTAATCTAACC TTCACTGTAACCTCCATAG GTGCCTCTATTGCAGTTCCGCAGACCTCACCATCACCTTGAGCTAAGTGGGTATCACCTA TGGAAAGTAGTGCTCCATTCACAAACACTGGGAGATATAACTTCGTGCCTACAGTTAAGTGCTTTATATCCATATTCCCT CCATTTTCCC TAGGAGGTATAGTACTCAGTTTTCCCCTAAAAGGTAAGCCGGTGCCTATAACACCTGGGAAAGGGTATA TGGGAACTTTAACGTTTAAATCACCAAACTTCGCATAAGCATATTTTTCGTCTACTTTCCAAATCTTGAGAGCTGGCCCT TGGAGATCTATGGGCGCAGTATATTGCTCGTCAGCAAGAAATCCAAACCCCGGAAGTACTCCAGTCCATCCCCAACCCTT ATGCCTAAACTCTAAGAACTCCACTTCTAAAGCATCTCCGGGTTCTGCACCCTTTACCTCTATGGGACCAGTTAATGGAT GAATTTTAGAAAAGTCCAGTTTTAGGAGATCCTTTTCTGTAGATGAAGGCGTAACTTGGCCATCAGAGGCTTCTTTAGTC TCCACTGTGATAATATCTCCATCACTTATTGTCAAAATTGGAGGTAAAGAATTATCCCATTTGTTGTGAGTTTTAGCGTG AATAGTATATTGCATAGTATTAGTTCTCCTT