SSO11221

Coordinates:2576047-2576175

>SSO11221 43 aa !not a gene!
MNNYNCRFSLLSSFRIYSKYSLMCLYEDTFIACWSYWIVRLEP

>SSO11221 43 aa !not a gene!
TTGAACAACTACAATTGTAGATTTTCTCTTCTCTCCAGTTTTAGGATCTACAGTAAATACAGTTTGATGTGCCTCTATGA
AGACACTTTCATCGCTTGCTGGAGTTATTGGATAGTACGACTGGAACCT


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2575547 - 2576675 (Additional range around SSO11221 is :500nt.)

>Sulfolobus solfataricus P2 CAAATGGGGATATACCATCTTCAGTTATCTCAAATCTCTTCAATTCTGGCGTATTTGTATTAATTACAATCTTACCTTTT TCTATCCTTATATTCTCCATTCCTAACGTTTTCTTAGGAATAATTGAATAGGAGTTAGCTAGTGCCTTATCTACCAAATG TATTACTGGGGTTTGATATTTTTGAGCTAGGTTAAGTGCCCAAGTACCATCGTGAAAAGCCTCAACGTGATCACCTGAGG CTATAACTATTCTGGGGAATTCACCATGTCCTGCATTTAGAGCGAACATTAGATCGGCTTGAGACGTTCTAGTTGGCTGG CCAGTTGAGGGTCCTCCTCTGATATAGTAGGTAATTACAACAGGTACCTCATTCATTCCAGCCCATCCCATTCCCTCAAC CATTAAGGAGAAACCTGGGCCAGATGTAGCTGTAGCTGCTCTCACCCCAGTTAAGGCGGCACCAGAAGCCATATTTATTG CCGCTAACTCATCCTCTGC TTGAACAACTACAATTGTAGATTTTCTCTTCTCTCCAGTTTTAGGATCTACAGTAAATAC AGTTTGATGTGCCTCTATGAAGACACTTTCATCGCTTGCTGGAGTTATTGGATAGTACGACTGGAACCT TAATCCACCA TAAATCTTGCCTATTGCCGCTGCAGTATTACCATCTAGATTGATTTTCTCTTCGTTGTTGGGTAATTCTGGTAAATTATA CATCGGTTGAATTTGTTGCATTGCTAACTGTGCAGCTATGGTATTTATCTTAGCGAAAACTTCTTGTCTAAATGTTCTGG TAATAGAGTTTATCAGATATTGTTCCTTTAATCCTAGTAATTTGTAAGAGGCTGCTATAGCTATGGTATTCCTTGCCCTA TCAGCTACACTTAACTGTACTTTAGCCTGGTCTGCAACCTTCTTTAAAATCTCCATGTAATCGATTGGTATTACTTTAAC TCCTTTCTCTTTCTTCAAATAATTTATTACGTCCTTTACTGTAGTCCCATAACCTTTTTCCTTCAAGAATTTAACTACGT GTTCAGTGATTTCCGGTTCCATGCTCTGGACTTGTTCAGCCTTGGTATTCTCAACTTCCGTACTATATATTAATACGTCT TTTACTTCAT