SSO11239

Coordinates:2585977-2586165

>SSO11239 63 aa !not a gene!
MTGQTVTHVPQFTHEELPMGFPLSQTTLGGLRSQLIHITSFTAKSWQASTHLPHRIHCDGSYM

>SSO11239 63 aa !not a gene!
TTGACTGGACAAACAGTAACGCACGTACCACAATTTACGCATGAGGAGTTGCCTATGGGATTTCCGTTATCCCAAACTAC
TCTTGGAGGATTGAGATCCCAATTAATCCATATTACCTCATTTACTGCAAAATCTTGGCAAGCCTCAACACATCTACCGC
ATAGGATACATTGTGATGGATCATATATG


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2585477 - 2586665 (Additional range around SSO11239 is :500nt.)

>Sulfolobus solfataricus P2 GTAAGTACGCCTCTTCATTGCTCATCTTATCTGAGGCTATGAAACCTATGGAATCTGGACCATATCTCTCCTTGATCTCC TTCAATCTTTTAGCTATGTACGAGATTGCCTCATCCCAACTAGCTTCCCTAAACTTATCACCCTCCCTTATTAAGGGCTT AGTAATTCTTTCCGAGCTATTTACAAAATCCCAGCCGAATTTACCCTTTACGCAAGTTAGAATACCATTGGCTGGTGACT CAGGTTTTGGCTCAATTTTTAATATTTTCCTACCCTTAGTCCAAATCTCAAATGAACAACCAACACCACAGTATATACAG ACTGTTTTAGTTTTCTTTATTTGTGATTCCCTAGCCTTAGCCTCTATCTCGCTAAAGGTCATTAATAAGCTAAAGTTATC CTCAGCTTTCCCTATAGCCTCTATTGCTTTTTTCTTTAAATCCTTATTAATCCAAGTGAGATAGCCAGCCTCTCCCAACA TTGATTTTTCCATTAATGCG TTGACTGGACAAACAGTAACGCACGTACCACAATTTACGCATGAGGAGTTGCCTATGGG ATTTCCGTTATCCCAAACTACTCTTGGAGGATTGAGATCCCAATTAATCCATATTACCTCATTTACTGCAAAATCTTGGC AAGCCTCAACACATCTACCGCATAGGATACATTGTGATGGATCATATATG TAAAAGGGACCACTTTCATCCGTTTGATA AGGCTTTTCTACGTACTTTTGAGAATTAATATTCAATTTTATTACAGCCTCGTGAAGTACGCAATCCCCATTATTATTCT CACAAATACTACAGTACAATTTGTGATATCTTAGTATTCTGGAGATTGCGGTCTTTCTTGCTTCCATAGCTCTTTTAGAG TTAACTGAGATACTCATTCCATCTTCGACTCTTGTTGAACAAGCTCTAACTAGTTTCCCATTAACCTCAACTAGGCATGA ATCACAGCTCTCTATGGGAACTAATCCTTCATTGTAACATATGTGTGGAATGTAAATACCATTCCTCTTTAGTGTTGATA GAATTGTCTCTCCTTCATTAGCTAATACCTCTTTATTATCGATAACTAGTTTTATTGACACAAGACTCATCTCTTGTTGG AATCTTAAAAAGTTTGTTAACTAAAATTTTCAAAAGTTAAAAATAAGGGGCTTGATAAATTACTTACATA