SSO11254

Coordinates:2593473-2593703

>SSO11254 77 aa !not a gene!
MPIRNNRCPLSLCNLSISPLYFSHLVKQRKLPHQISLVARTLRQSPEVHLLLRLLSPLSSYRANLEVSLTLYLLTYE

>SSO11254 77 aa !not a gene!
TTGCCAATAAGGAATAATCGATGTCCTCTCTCTTTATGTAACCTTTCCATATCTCCTCTCTACTTTTCTCATCTGGTAAA
GCAACGTAAATTACCTCATCAAATCTCCCTGGTCGCAAGAACGCTTCGTCAATCTCCTGAGGTACATTTGTTGCTCCGAT
TATTATCACCCTTAAGTTCTTATCGTGCAAATCTTGAAGTCTCATTAACATTATATTTACTAACCTATGAG


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2592973 - 2594203 (Additional range around SSO11254 is :500nt.)

>Sulfolobus solfataricus P2 GGCATTATCTAGGGCAATATAGAATTTCTCAGCTATAATCTTTGGGGCATCCAGAGGACCAGCACCACTGACCTCTTCTC CAGATAGTTCTATGAAGTTGAACCTCAAATCGTTAGCTAGAGCCTTAGCAATGCTAGTTTTCCCTGTCCCCGGTGGACCA TATAACAGTATACCTTTAACCGGATATATTCCCAGTTTCTCTGCAAACTCCTTGTTGGTTATGGGTAATACTATGGACTC CCTAATTATCCTCTTAACCTCTTCTAAATCCCCTAAATCGTTCCAAGAAATGTTGGGAATACCATACGTCTTTATTATTA ATTTACTCCTCTCATACTTTCTAGCGATATTTTCAAATTTAATTATGGTTGAAAGTTGAATGGAGGGTTTGTAATTCTCA ATCTCTCGTAGAAAGTCCTCAGTTTTTAAACTATTATTCTTACTTATTACCTTATCAGCAACGTTCTTAATATCCGCAGG AGAAAATCTCTCACTTTTCT TTGCCAATAAGGAATAATCGATGTCCTCTCTCTTTATGTAACCTTTCCATATCTCCTCT CTACTTTTCTCATCTGGTAAAGCAACGTAAATTACCTCATCAAATCTCCCTGGTCGCAAGAACGCTTCGTCAATCTCCTG AGGTACATTTGTTGCTCCGATTATTATCACCCTTAAGTTCTTATCGTGCAAATCTTGAAGTCTCATTAACATTATATTTA CTAACCTATGAG TAACCTCATGTAAATCGCTTTGCCTACTCATTGCTAAGCTATCTAATTCATCTATGAATACAACAGC TGGAGTGTTAATTTCTACTTGATCGAAGAAGCTATCTAATAGGAGTTCACTTTCACCGTACCACTTACTCAATATTTTAC TTGGCCTTAACTCAAAGTAAGCCCAGCCCAATTTATTCGCTAAAGCCTTAGCGATTGTTGTCTTTCCTGTCCCAGGTGGA CCAAAGAGTATAACTCCATATGCTCTTCCCTCTTGTACAATTTTAGCTATTTCCTCTAATCTCATTTTGACATCTTTCAA ATCATATACCTCATCCCATCTAATATTAGGAATATGAATCTTAGGTTTTCTACTTTTAGTCGTATTACCTATCATCATCC TCCTAGAGAAGTAAATCCAGAAAATTAATGGAACTAGAAAGAATAGTATTGTGAGAATTACCTCAATGATTAGCTGTAAA GTATTACTGCTTAATCCTAATCCTATAGTAGA