SSO11265

Coordinates:2598803-2598931

>SSO11265 43 aa !not a gene!
MISQFPVTLIVLHLILLPVYPTTYPTSLFLKYYMPFLLTLLPP

>SSO11265 43 aa !not a gene!
GTGATCTCGCAATTTCCAGTAACTTTAATTGTCCTCCACTTAATTCTCTTGCCGGTCTATCCCACAACCTATCCAACTTC
ACTATTTTTAAAATATTATATGCCTTTTCTGCTAACTCTTCTTCCTCCC


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2598303 - 2599431 (Additional range around SSO11265 is :500nt.)

>Sulfolobus solfataricus P2 TAAACTAATCCTTTTCTAGATCTCTTATAGGGAGGAAATCTAGTTATATCATCTCCCTCAAATATTATTTTCCCAGATAT TACGTTAGTTAAACCTACTAGGGTCTTAAGGAATGTGGACTTCCCACTTCCATTAGGTCCTACAATAGTTATGATTTGCT TCTTACTTGCAATAAAATCCACATCGAATAGGATCTGTAATTTGCCATAACCCGCATTAAGTTTAACCGTCTCTAACATC TGCCATCACCCTAGATACGCATCTACTACGGTGGGGTTATTAAGCACATCATTTACTGAACCTTTAGCTATTACCTTTCC CATGAACATTGCATACACGTAATCAGCATAATTAGCAACTATATCTAATCTATGTTCCACAACAAAGATCCCTATGTCCC TCTTGAGATCTGTAAGGATATTCAATATTTCTTTTGCTAATTGCGGATTGACTCCAGCCAATGGTTCATCCATAACCAAA AGCCTAGGTCTAGTCATTA GTGATCTCGCAATTTCCAGTAACTTTAATTGTCCTCCACTTAATTCTCTTGCCGGTCTAT CCCACAACCTATCCAACTTCACTATTTTTAAAATATTATATGCCTTTTCTGCTAACTCTTCTTCCTCCC TAAGCCAAAT GGGCTTAAACAACGATCTAAGTATTGATTCACCCTTAATTGGCGATATGCCTAAAATTACGTTATCCAATACTGATAAAT TAGGAAAAATCTGTGGGTTTTGAAAAGTTCTAACTATTCCTAGTTTATACAACTCGTGGGGTTTCTTTCCAGTTATGTTT CTATCTTCAAGAAAAATACTTCCAGAGTCTGGTTTATAAATGCCAGTTACAACGTTGATTAAAGTCGACTTCCCGCTTCC ATTAGGTCCTATAAGTAAAGTGAATTTGGAATTCTCAATCTCTAATGTTACACTATCTAATGCCTTAATACCACCGAAAT ACTTAGAAACGGAATCCAATTTAAGAAGAGACAAAAAACAACACCCCTTTAATATTAACTTATACTACTTAACTTAGACA TAGCTTGGGGATCATCTGGATAAAGATAGCCTTGTGGGGGTTGAGCAGCTGGAGGGAATCCTATGGTTAATGTATGCGTG GTAACATCAT