SSO1545

Coordinates:1395998-1397068

>SSO1545 hypothetical protein SSO1545
MLFDTSPKDNRKDFFDREKEIEKLKGLRAPITLVLGLRRTGKSSIIKIGINELNLPYIYLDLRKFEERNYISYKDFLLEL
QKEINKLVKRLPSLLKALKNIQGIVIMGNEIKFNWNRKDRLSFANLLESFEQASKDNVIIVLDEAQELVKLRGVNLLPAL
AYAYDNLKRIKFIMSGSEMGLLYDYLRVEDPESPLFGRAFSTVELKPFSREEAIEFLRRGFQEADIDFKDYEVVYEKIGG
IPGWLTYFGFIYLDNKNLDFAINQTLEYAKKLILKEFENFLHGREIARKRYLNIMRTLSKCGKWSDVKRALELEEGIEIS
DSEIYNYLTQLTKHSWIIKEGEKYCPSEPLISLAFS

>SSO1545 hypothetical protein SSO1545
GTGCTATTCGATACTTCACCTAAGGATAACAGAAAAGATTTCTTTGATAGAGAAAAAGAAATTGAGAAGTTGAAAGGATT
GAGGGCGCCAATAACCTTAGTTTTAGGATTGAGAAGAACAGGGAAATCATCCATAATAAAGATAGGAATAAATGAGTTAA
ATCTCCCTTACATCTATCTGGATCTAAGAAAATTCGAAGAGAGAAATTACATTTCCTATAAGGATTTCCTACTTGAACTT
CAAAAGGAGATTAACAAGTTGGTAAAAAGACTTCCTTCATTACTGAAGGCGCTAAAAAACATTCAAGGGATTGTGATAAT
GGGAAATGAAATTAAGTTCAATTGGAATAGGAAGGATAGGTTAAGTTTTGCGAATTTATTGGAGAGCTTTGAGCAGGCAT
CAAAGGATAATGTGATTATTGTCCTTGATGAGGCTCAGGAGCTGGTTAAGTTAAGAGGAGTTAATCTTTTACCAGCACTA
GCTTATGCGTATGATAATTTAAAGCGAATTAAATTTATTATGAGTGGTTCAGAGATGGGTTTGCTTTACGATTACTTAAG
AGTTGAAGATCCAGAAAGTCCGCTTTTCGGGAGAGCCTTTTCAACGGTTGAATTAAAGCCCTTTTCTAGAGAAGAAGCTA
TAGAGTTTTTGAGGAGAGGTTTTCAAGAGGCAGATATTGATTTTAAGGATTACGAAGTCGTTTATGAGAAAATTGGAGGA
ATACCAGGTTGGCTAACCTACTTTGGTTTTATCTATTTAGATAATAAGAATTTAGATTTTGCAATAAATCAAACATTGGA
GTACGCTAAAAAGCTTATCTTAAAGGAATTTGAGAATTTTCTACATGGCAGAGAAATCGCTAGAAAGAGGTATTTAAATA
TAATGAGGACCTTATCAAAATGCGGTAAATGGAGTGATGTCAAGAGGGCTTTGGAATTGGAAGAGGGAATAGAAATATCT
GACTCAGAAATTTATAACTATTTAACACAATTAACAAAACACTCATGGATAATTAAGGAGGGTGAAAAATATTGCCCTTC
AGAGCCTCTAATTAGTTTAGCCTTTTCTTAA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 1395498 - 1397568 (Additional range around SSO1545 is :500nt.)

>Sulfolobus solfataricus P2 TCCCGTTTCATAAACTTGCATAACGGAGTCATGGAGTCCCTCGCTTTAACCCTTTCCTGTTCACCTCCTCCCTAGACCTC CCCTCCCCGCTTGATAATGCTAAACAGATGATATTACCCTCTATATACAAACTCCTTTTTAACCATGCTTCTCGTTTAAT CTAAAAATTTTTTGATAATCATGTTGAAATAAGCCGATTTTCACAACCATAACTCGATATTTTCCCCTACCATAGAAATT ACATCATTTCTAGTAAAATTGGTGAAACACAACTGTACTTCTTAATATTATAGCTTATCAATAAGCATTTCTCATCTAAT CAGGAAAGATTCGTTATATATTTTTAATGTAACGTAAAAGTGTAACGATTTTCCTATAAATGCTATTCGAGTATCTTCTG GGAAACCGATTAACCAACTTAACGAGTTGCTGGTAAAGCCAAAAAAGTCGAGGGAAGTTTTTTAACTTCTGGGGGTAGAA GTTACTTCTGGGGGTAGAA GTGCTATTCGATACTTCACCTAAGGATAACAGAAAAGATTTCTTTGATAGAGAAAAAGAA ATTGAGAAGTTGAAAGGATTGAGGGCGCCAATAACCTTAGTTTTAGGATTGAGAAGAACAGGGAAATCATCCATAATAAA GATAGGAATAAATGAGTTAAATCTCCCTTACATCTATCTGGATCTAAGAAAATTCGAAGAGAGAAATTACATTTCCTATA AGGATTTCCTACTTGAACTTCAAAAGGAGATTAACAAGTTGGTAAAAAGACTTCCTTCATTACTGAAGGCGCTAAAAAAC ATTCAAGGGATTGTGATAATGGGAAATGAAATTAAGTTCAATTGGAATAGGAAGGATAGGTTAAGTTTTGCGAATTTATT GGAGAGCTTTGAGCAGGCATCAAAGGATAATGTGATTATTGTCCTTGATGAGGCTCAGGAGCTGGTTAAGTTAAGAGGAG TTAATCTTTTACCAGCACTAGCTTATGCGTATGATAATTTAAAGCGAATTAAATTTATTATGAGTGGTTCAGAGATGGGT TTGCTTTACGATTACTTAAGAGTTGAAGATCCAGAAAGTCCGCTTTTCGGGAGAGCCTTTTCAACGGTTGAATTAAAGCC CTTTTCTAGAGAAGAAGCTATAGAGTTTTTGAGGAGAGGTTTTCAAGAGGCAGATATTGATTTTAAGGATTACGAAGTCG TTTATGAGAAAATTGGAGGAATACCAGGTTGGCTAACCTACTTTGGTTTTATCTATTTAGATAATAAGAATTTAGATTTT GCAATAAATCAAACATTGGAGTACGCTAAAAAGCTTATCTTAAAGGAATTTGAGAATTTTCTACATGGCAGAGAAATCGC TAGAAAGAGGTATTTAAATATAATGAGGACCTTATCAAAATGCGGTAAATGGAGTGATGTCAAGAGGGCTTTGGAATTGG AAGAGGGAATAGAAATATCTGACTCAGAAATTTATAACTATTTAACACAATTAACAAAACACTCATGGATAATTAAGGAG GGTGAAAAATATTGCCCTTCAGAGCCTCTAATTAGTTTAGCCTTTTCTTAA TCGTTTTTCTGACTCCTGCCTGCCCTAA ACGGTAGACCCAAAATCATTTTATAAAAATAATTTGGATTGAATAATATTAGATCTATTTAACATAATCAAGTTTATAAC AACATTAAGAATCCAATAAATTGGAAAAAAGGTTTAAAGCGAGGAAATCGGTATTACCATGAGGGTTCATGAGAATACCA ATTCCCTCATTAAATAGTCAACAAGCAAGATATAAATTACTTTCCATGTTAAACTTCCAAGGGAAAAAGGCAGAAAACCT AGAAAAACATTAATCTCAGCATGTTTATGGAACGACTCCATAGAGAGCAAGTCAAGCGCGTACAACATATCACCACAAAC CGTGAGAAACTACGCGGAGGAGCAAGGAGTGGATAGTTGAGAAACTCTTGAAACAAGTGAGGAATCCTTGGAGACGATGA AAGGAGAAAAGGAAATAGACTGGACCACTAAAACTTGGTACGGAAAACCGGTGAAAGGACTCAGAAAAGGGA