SSO1932

Coordinates:1751793-1752224

>SSO1932 hypothetical protein SSO1932
MNISSQNKIYTVKRNLILEYCKTPKSFTELRDLTGMSDAGLSKALNDLIKKGYLQKTSDGKYVITDKVMQSYKERIVNRI
WFKYQGISDEKIEKIADLLKDEGEFYILASKGKDKTDDLTLLLQYLFLLTYEIEGSKELKVTQ

>SSO1932 hypothetical protein SSO1932
ATGAATATAAGTAGTCAGAATAAAATTTATACTGTGAAGAGAAATTTAATACTTGAATATTGCAAGACTCCTAAATCCTT
CACGGAACTAAGGGATCTAACTGGGATGTCTGATGCGGGTCTATCTAAGGCACTAAACGACCTTATAAAGAAAGGGTACT
TGCAGAAGACTTCGGATGGAAAATATGTGATAACCGATAAGGTAATGCAAAGCTATAAGGAGAGAATTGTTAATAGGATT
TGGTTTAAATATCAAGGAATCTCAGATGAGAAAATTGAAAAAATAGCTGATCTTTTGAAGGACGAGGGAGAATTTTATAT
TCTAGCTTCTAAAGGCAAGGATAAGACAGACGACTTAACGCTTCTGCTACAATATCTATTTCTACTTACATACGAAATTG
AGGGGTCAAAGGAGCTGAAAGTCACGCAATAG


Sulfolobus solfataricus P2

Sequence spaning coordinates : 1751293 - 1752724 (Additional range around SSO1932 is :500nt.)

>Sulfolobus solfataricus P2 TTTTTTCGATCAAAAAGTTTAAATATTTACTCTACCAAAGTAAAGTTGAGTGAAGAAAAAATGAGTGAAGAAAGTCCATT TGATAAGATTATGCATATGCCTCTTGATAAAGTAAGAGAAATACTTAATAGAACAAACCTGGAGAGGCAAGTATTTAATG AAATTGTCGGAGATAACTGGAAGGTAAAAATCATAGAAACAAAAGTGAATAAAAATAATTATGAAACTATATATAGATTA TATGGTATTTATCTCGGAGATAAATCCGTAGCAGTAAGTGTTACAAGTGACGGAAAACTTAGACATATAATATTAAATGA CGTAAAAGTAGTTAGTGAAACAGACCAGACTGTAAAGAAGAAAAATACCATGCTATTACTGGACTATGAAAATCAGAGGG CGATATTTACTGAAGGTGAAATGGAACTATGGAAAGGTAAAATTGGTTTTGACGCAATTAAGTCAATTAATATCCTAAAG AACGAATCAAGGGACTTTCA ATGAATATAAGTAGTCAGAATAAAATTTATACTGTGAAGAGAAATTTAATACTTGAATA TTGCAAGACTCCTAAATCCTTCACGGAACTAAGGGATCTAACTGGGATGTCTGATGCGGGTCTATCTAAGGCACTAAACG ACCTTATAAAGAAAGGGTACTTGCAGAAGACTTCGGATGGAAAATATGTGATAACCGATAAGGTAATGCAAAGCTATAAG GAGAGAATTGTTAATAGGATTTGGTTTAAATATCAAGGAATCTCAGATGAGAAAATTGAAAAAATAGCTGATCTTTTGAA GGACGAGGGAGAATTTTATATTCTAGCTTCTAAAGGCAAGGATAAGACAGACGACTTAACGCTTCTGCTACAATATCTAT TTCTACTTACATACGAAATTGAGGGGTCAAAGGAGCTGAAAGTCACGCAATAG AATAGATAGCCAATTTTGTAAATTAA CATACAATATAGCTATTAACCTAAAAATTCGTCACTTAGCTGATCTTCATAAAGAGAAGTCTTACACTGATATTCGTATA TGTGTTTGAGATATAGAAATAAATAATATGATTATAAAATTAACTTTGACTCTTCCTCCAAGCACTATGGACGATTCGTT TTATTCTTTATGACAGAAAAAGATTAGATACTAAAGAGTTTGGACTTTATTTCGTGCTTAGCATTAGTTACTGTACTAAA ATATAGATATCTTATTAAATTTCGATTAAGAACTGCCTTTATAGAATCTTAATAAGATGTAATTATAAAAACTTTTATAA AAAGATTATAATTCCTTTAATACTTCGGCCAAGCTTATTTCTTGATGAGATGTTATGACAATGCTATAATTATCTTGTTT ATTTATCCCTATCATTACGAATAGGCTCCTATTGTAATAAGTTGCATTTATTGAATAGACTACAACAGTAGCA