SSO1958

Coordinates:1774144-1775268

>SSO1958 Transport membrane protein (permease)
MLRNIIVSWIGTFLQLFLRLSWGVISLPIALVFHLNSIQIGLVATVFYIGYVVSSIPWGLIIDRIGPSSAVEYASILLVG
MNLLLFLFLTSYAILLVAYLIEGLITAAIFPSAMKIVAVSYSNSSKFTFYVALVESAGPITIITLGIIASFLLHLWRFIY
LIMAISFGLIAIFSHFNRIDVNRTEIKRSFKIILDRKITIATLIRLGELWSTWGTTTWIFPMLVLYRNISPTLSALFLLL
FGVGQLVGILSVERLVERFGDRTVILINLIGFILLTFSIIFSNNIDILPEAFLLGIFSFSYRPPTDSLIMRIAGQSSAGT
SIGYANAVSQIGTMIAPSFVGLTLYLTHSFSISMLALDVGCIISIISLLSLKHL

>SSO1958 Transport membrane protein (permease)
GTGTTAAGAAATATAATAGTGAGTTGGATTGGTACTTTTCTTCAGTTGTTTTTAAGGCTCAGTTGGGGAGTCATATCATT
GCCAATAGCCTTAGTTTTTCACTTAAACTCCATACAGATTGGGCTAGTTGCCACAGTCTTTTACATAGGTTATGTAGTTT
CCTCAATCCCTTGGGGTTTGATTATAGATAGAATAGGCCCAAGTAGTGCTGTGGAGTACGCATCGATTCTCTTAGTAGGA
ATGAATCTATTACTCTTTCTCTTCCTTACAAGTTACGCTATTCTACTCGTAGCCTACCTCATAGAAGGACTTATAACAGC
TGCCATATTTCCATCAGCCATGAAAATAGTGGCAGTTAGTTACTCCAACAGCTCAAAGTTCACATTTTACGTGGCTTTAG
TGGAAAGTGCAGGACCAATAACTATCATCACCTTGGGTATAATAGCAAGTTTTCTGTTGCATTTATGGAGATTTATTTAC
CTAATCATGGCCATAAGTTTCGGGCTAATTGCAATTTTCAGTCATTTCAATAGGATAGATGTCAATAGGACTGAAATCAA
GAGGTCGTTCAAGATAATCCTTGATAGAAAAATAACAATTGCAACGCTAATTAGATTAGGGGAGCTGTGGTCCACGTGGG
GTACAACAACGTGGATTTTCCCAATGTTAGTACTTTATAGAAACATCTCTCCGACTTTATCAGCCCTATTTCTTCTTCTT
TTCGGAGTTGGTCAGCTAGTAGGGATTTTAAGTGTGGAAAGGTTAGTGGAAAGATTTGGCGATAGAACCGTTATCTTAAT
AAATCTGATAGGATTCATCTTACTAACGTTTTCAATAATTTTCTCAAATAACATCGATATATTACCCGAGGCCTTCTTAT
TGGGGATTTTCTCGTTCTCATATAGACCTCCAACTGATTCTCTAATAATGAGAATAGCTGGGCAATCTAGTGCGGGAACT
TCAATAGGTTACGCCAACGCCGTATCCCAAATTGGGACGATGATCGCTCCATCATTTGTAGGTTTGACACTGTATTTGAC
CCATAGCTTCTCTATATCAATGTTAGCCTTGGACGTTGGGTGTATAATATCTATCATATCACTTTTATCCTTGAAACATT
TATAG


Sulfolobus solfataricus P2

Sequence spaning coordinates : 1773644 - 1775768 (Additional range around SSO1958 is :500nt.)

>Sulfolobus solfataricus P2 GTTCGAACTCTTCAATTCTATTATTCTTAGCAAGCTCCACTAATTGTGAAGCAATATCAATCATTTTCATATCGTGATTA ACTATTTGATCCAACTCCTCAGTTGTAACTTTCCACCTGGCGTAAATATCCGCACCTCCACCCTGACTTGACATTATATT GTTTATTAACTCCCTGATTTTAGAGATCAAGAACTCCATTACCTTAAGTTGGGGTGAAAATGGATCGGTTGAGGCAATAA AGCTTTCCTTTTCTGAGATTATCCTTATCGTTTGTTCTAATCTATCAATAACTGCTCTTCTAACTAGGAAATCGTCTTGT CTAATTAGATCTTTTGCTTTATACCCCCTATAACCTGGTAAAAGTAATTGTAACTGCTCAATGGGGGTTAACTCTCTTGG CATAATTGAATATACGCCTAGGAGATTATAAAATTATTTTATGCTAAATATATTTTAGAACGATAATCATAAAAGAGAGA TTTAACTCATTGTCATTTT GTGTTAAGAAATATAATAGTGAGTTGGATTGGTACTTTTCTTCAGTTGTTTTTAAGGCTC AGTTGGGGAGTCATATCATTGCCAATAGCCTTAGTTTTTCACTTAAACTCCATACAGATTGGGCTAGTTGCCACAGTCTT TTACATAGGTTATGTAGTTTCCTCAATCCCTTGGGGTTTGATTATAGATAGAATAGGCCCAAGTAGTGCTGTGGAGTACG CATCGATTCTCTTAGTAGGAATGAATCTATTACTCTTTCTCTTCCTTACAAGTTACGCTATTCTACTCGTAGCCTACCTC ATAGAAGGACTTATAACAGCTGCCATATTTCCATCAGCCATGAAAATAGTGGCAGTTAGTTACTCCAACAGCTCAAAGTT CACATTTTACGTGGCTTTAGTGGAAAGTGCAGGACCAATAACTATCATCACCTTGGGTATAATAGCAAGTTTTCTGTTGC ATTTATGGAGATTTATTTACCTAATCATGGCCATAAGTTTCGGGCTAATTGCAATTTTCAGTCATTTCAATAGGATAGAT GTCAATAGGACTGAAATCAAGAGGTCGTTCAAGATAATCCTTGATAGAAAAATAACAATTGCAACGCTAATTAGATTAGG GGAGCTGTGGTCCACGTGGGGTACAACAACGTGGATTTTCCCAATGTTAGTACTTTATAGAAACATCTCTCCGACTTTAT CAGCCCTATTTCTTCTTCTTTTCGGAGTTGGTCAGCTAGTAGGGATTTTAAGTGTGGAAAGGTTAGTGGAAAGATTTGGC GATAGAACCGTTATCTTAATAAATCTGATAGGATTCATCTTACTAACGTTTTCAATAATTTTCTCAAATAACATCGATAT ATTACCCGAGGCCTTCTTATTGGGGATTTTCTCGTTCTCATATAGACCTCCAACTGATTCTCTAATAATGAGAATAGCTG GGCAATCTAGTGCGGGAACTTCAATAGGTTACGCCAACGCCGTATCCCAAATTGGGACGATGATCGCTCCATCATTTGTA GGTTTGACACTGTATTTGACCCATAGCTTCTCTATATCAATGTTAGCCTTGGACGTTGGGTGTATAATATCTATCATATC ACTTTTATCCTTGAAACATTTATAG TGGTTTTCATATAATATTAAAACGTGGATTTAGGTAAAATTATAGGTTTAATAG TGTTCATTTCAGTACTAATTGTTCAGTTTGCCATGATTAATAACTTCAACGGTTTACTTCAAACAACTTTGAACCAAATC AACTCCACCATACTCATATTATTCACTTCGCAACCAAAAATAGGTCTAGTTATTTCCAATAACCAGTTAATCTTAACTTT TAACAATACTCTCAACTTCCCAATAACCTTACTAAACGTAACTGGGGATTACACTTACTTATCAAAACCGGTAACAATTA ACCCTAATGAGGTAAAGAACATTAGTGTGGTTGTGACTAATTTGGAAATGTTCGAGAGGGCTATTCACGATAATTCATAT AACTTGACGATAGTGATGAAGATGTTCAACACAACTTTTTCACAAAGTGAGATGATATGATAGTTACAAAAAGAACGTTA ATATTGACTATAAGCATGTTACTAAATGTACTTGTAGCGTTATTAC