SSO2055

Coordinates:1874110-1874577

>SSO2055 hypothetical protein SSO2055
MSETIRNIMRLFPLGIVVVTTKWSDNLVGMTVNTFNSLSLNPPLVMFTADKTKGNDVPFIESNGFIVNFVDDEKIFNTFA
FKPIKERFKEAKFFEGLDGIPVLADSYAYMEVKKYKTIDIGDHTIVVGEVINGKIVRDNFSPLVYYNRNYWKLCR

>SSO2055 hypothetical protein SSO2055
ATGAGCGAGACGATAAGGAATATAATGAGATTATTTCCACTAGGAATAGTAGTAGTTACAACTAAATGGAGTGATAATTT
AGTAGGAATGACGGTCAACACATTTAATTCGCTTTCTTTAAATCCACCATTAGTTATGTTTACCGCAGATAAAACTAAGG
GTAATGATGTACCTTTTATCGAGAGTAATGGTTTTATAGTAAATTTTGTCGATGACGAAAAAATCTTCAATACATTTGCC
TTTAAGCCCATAAAGGAGAGATTCAAGGAGGCAAAGTTCTTCGAAGGTTTAGATGGAATACCCGTATTGGCTGACAGTTA
CGCTTACATGGAAGTTAAGAAGTATAAGACTATTGATATTGGTGATCACACCATTGTAGTTGGTGAGGTAATTAATGGAA
AGATTGTTAGAGATAATTTCTCACCCTTAGTCTATTACAATAGAAATTATTGGAAGTTATGTAGATAA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 1873610 - 1875077 (Additional range around SSO2055 is :500nt.)

>Sulfolobus solfataricus P2 GTTCCTATAACAACCTTCTTTGTTGGAGATAGACTTGAAAGAAAGACGTGGACAGTCATTTCAGTAGTCTTCACAATAAT TGGGGGATTATTAATAGCTATAGCTGGTACTAACATAGCATTATCTTTCCTAGGATCTATAATTCTCTTTTATGGTTTTA ATTTATGGGTTCCAACATCATACGCTTGGACTGCTGAGAGTTTTCCGACTAGGGCTAGGAGTACTGGTTTCGCCTTATGT GACGGTGTAGGTCATATAGGGGGTGGGATAGGGATTATTGCAATTTCCTCTTTCATAGGTTCTCTGATAGCTTCTGGGGT CACTACAGCTTTGGCAATAGAGGTATTTTTGCTAATAGCCTTATTCCAAGTAATTTCAACAATAATTGCAATAGCAATAG GACATAGGTCTGCTAATAAGAGATTGGATGAGGTTTCACCCTAAGACATCAACTCAGTTTAATGATAAACTTAAATAATT TTTTTAAGTATATACTCTC ATGAGCGAGACGATAAGGAATATAATGAGATTATTTCCACTAGGAATAGTAGTAGTTACA ACTAAATGGAGTGATAATTTAGTAGGAATGACGGTCAACACATTTAATTCGCTTTCTTTAAATCCACCATTAGTTATGTT TACCGCAGATAAAACTAAGGGTAATGATGTACCTTTTATCGAGAGTAATGGTTTTATAGTAAATTTTGTCGATGACGAAA AAATCTTCAATACATTTGCCTTTAAGCCCATAAAGGAGAGATTCAAGGAGGCAAAGTTCTTCGAAGGTTTAGATGGAATA CCCGTATTGGCTGACAGTTACGCTTACATGGAAGTTAAGAAGTATAAGACTATTGATATTGGTGATCACACCATTGTAGT TGGTGAGGTAATTAATGGAAAGATTGTTAGAGATAATTTCTCACCCTTAGTCTATTACAATAGAAATTATTGGAAGTTAT GTAGATAA CCTTAAATCAGTTTAATAGTGAATTAATTTATCTTTTTGCACGTGATAGTGTTTGATGATCAACACTTTAC GTACATCTCATGTGTGTATAAGAGTTAGCGATTTGGATAAGGCGAGATACTTCTACTCAGAACTCTTAGGATTTGTGGAG ACAGAAAAGGATGGCGATTATATTTATTTGAGAGGGATTGAGGAAGGTCAGCATCATAGCTTAATACTAAAAAAGGCCAA CTCGGCTGGTTTATCGTATATAGGCTTTAGGGTAAGTAAAGGAGAGGAATTAGATAAGGCCAGAGAAGAATTGGAAAACC TAGGTCATAAGGTTAGGAAATTTAGGGAAAAGGGTATTAATGAAGCTCTATTATTTGAATCCCCCGAAGGAATCCCAATA CTTCTATACTATGACATGGAGTATGTAGGCGATTTAAGATTAGCATTTCATAGGCATAGGGGAGTGAGTCCAGTCAGGTT AGCCCACGTAAATTATATGGTTAAGGACT