SSO2274

Coordinates:2083299-2084168

>SSO2274 Dihydrodipicolinate synthase (dapA-1)
MKENISALVTPYDDKENINTEALQQLLDFLIKKGIKDFWVLGTSGEFNMLSQDERILVVSKIREMVKGKIYVGVNENSTR
NSLILAKKYYDLGVDYIFSVPPIYHKPSEKGLISYFSELRNAIDLPLFIYNIPSFTGYNVPLHIIEKLAREYVLDGMKYS
TTDFVSFLKYLKALKGVNKNFKVFIGEDRMILSALILDTDGAVSGISNLVPELVTNLFLEFDRGNIQRAIEIQRILNKLV
DVVSLGDYPSGIKIGLRYRGINVGSVRKPLLEDSRAEGEIYNVLKELGI

>SSO2274 Dihydrodipicolinate synthase (dapA-1)
GTGAAAGAGAATATTTCCGCTCTTGTTACACCCTATGACGATAAGGAAAATATAAATACTGAAGCGTTACAACAGCTATT
GGACTTTTTAATTAAAAAAGGAATTAAGGACTTTTGGGTTCTTGGCACTAGTGGAGAGTTTAATATGCTTTCTCAAGATG
AGAGAATATTAGTAGTTAGTAAAATACGTGAGATGGTTAAAGGTAAAATATATGTAGGTGTCAATGAGAACTCAACCAGA
AATAGTCTAATATTAGCTAAAAAATACTATGATCTAGGTGTTGATTATATTTTTTCAGTTCCACCTATTTATCATAAACC
TTCAGAAAAAGGACTAATATCGTATTTTAGCGAGTTGCGTAATGCTATAGATTTACCATTATTCATATATAATATACCCT
CCTTTACAGGATATAATGTTCCTCTTCATATAATTGAGAAGCTAGCGAGAGAGTACGTATTAGATGGTATGAAGTACTCA
ACTACAGATTTTGTCTCTTTTCTAAAGTATTTAAAGGCACTAAAAGGAGTAAATAAGAACTTCAAAGTATTCATTGGCGA
GGATAGGATGATCCTTTCCGCTCTTATTTTAGATACTGATGGTGCAGTTTCTGGTATTTCCAATTTAGTTCCTGAATTAG
TCACCAATTTATTCTTGGAATTTGATAGAGGTAACATTCAGAGGGCTATAGAGATTCAGAGAATTTTGAACAAATTGGTA
GACGTGGTAAGTTTAGGCGATTATCCCAGTGGTATTAAGATAGGTTTAAGGTATAGGGGAATTAATGTCGGTAGTGTTAG
GAAACCTTTATTAGAGGATAGTAGAGCCGAAGGTGAAATATATAATGTACTGAAAGAATTAGGTATATAG


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2082799 - 2084668 (Additional range around SSO2274 is :500nt.)

>Sulfolobus solfataricus P2 TAGATCCAAGGTTTATGATTAAAAACTCTTGCATGAATTCGCCAAATTAGAGCGGTATCTCTAACCCGTGTGGACAGTAA GAAGGCTTTCCTAAGTAATTATACAATTTATCGATAATCTCCTCGGGTATAAGATAGTCAAACTGTTTGGAATATTCACA AGCTGTTTGTTTATCTATTCCAATATTAACAAGTAGTATCTCTATCACTCTATGAGCTTTTATTAGGTAATTTATACTTC TCGTTCCATTATTGGTAATCCACACGCCATCTTCTTTCTTTTTCACTAATCCTTTCTCTTCTAAATGGGATACTTCCTCA AAAACGCTTGACGGAGCTATTTTTAGATCCTTTGCAATTCTATTTATCTTTGCACCTTCCCCACTGTCATTGTATCTTTT TATGGTAAGCAGATATGAGAATTCTCTTCGTGATAAGTTAGACATCTGTGAATCAACTCTCAATAAAAATAAATAAAGTT TTGTTCTAAAACATACAATC GTGAAAGAGAATATTTCCGCTCTTGTTACACCCTATGACGATAAGGAAAATATAAATAC TGAAGCGTTACAACAGCTATTGGACTTTTTAATTAAAAAAGGAATTAAGGACTTTTGGGTTCTTGGCACTAGTGGAGAGT TTAATATGCTTTCTCAAGATGAGAGAATATTAGTAGTTAGTAAAATACGTGAGATGGTTAAAGGTAAAATATATGTAGGT GTCAATGAGAACTCAACCAGAAATAGTCTAATATTAGCTAAAAAATACTATGATCTAGGTGTTGATTATATTTTTTCAGT TCCACCTATTTATCATAAACCTTCAGAAAAAGGACTAATATCGTATTTTAGCGAGTTGCGTAATGCTATAGATTTACCAT TATTCATATATAATATACCCTCCTTTACAGGATATAATGTTCCTCTTCATATAATTGAGAAGCTAGCGAGAGAGTACGTA TTAGATGGTATGAAGTACTCAACTACAGATTTTGTCTCTTTTCTAAAGTATTTAAAGGCACTAAAAGGAGTAAATAAGAA CTTCAAAGTATTCATTGGCGAGGATAGGATGATCCTTTCCGCTCTTATTTTAGATACTGATGGTGCAGTTTCTGGTATTT CCAATTTAGTTCCTGAATTAGTCACCAATTTATTCTTGGAATTTGATAGAGGTAACATTCAGAGGGCTATAGAGATTCAG AGAATTTTGAACAAATTGGTAGACGTGGTAAGTTTAGGCGATTATCCCAGTGGTATTAAGATAGGTTTAAGGTATAGGGG AATTAATGTCGGTAGTGTTAGGAAACCTTTATTAGAGGATAGTAGAGCCGAAGGTGAAATATATAATGTACTGAAAGAAT TAGGTATATAG GAATGATGAAGGTCGATGGGAATTACTGGATAATGAGGAAAATTATCCCCGGCTGAGGAATTATGGAT AACTTGGATCTTATTGCAGATGAGGTAAGAAAATGCCAAAAGTGTAAGTTATGGAAATTTAGGAAAAATGCTGTACCCGG AGAGGGTAATAGCAAAGCCGAAATTATGTTTATAGGAGAAGCACCTGGAGAGAATGAGGATATTGAGGGCAAACCTTTTG TTGGGGTAGCCGGTAAACTTCTAACTAGACTTATAAATGAGATCTTAGGTCTCAGTAGAGAAGACGTGTTTATAACGAAT TTAGTCAAATGCAGGCCTCCAAATAATAGGGATCCGGAAGAAGATGAAATACTTGCTTGCTCTCCATATTTAACTAGACA AATTGAATCTATAAGACCTCATATTATAATAACTTTAGGTAGGCATTCTACGTCTTATCTATTTAAGAAAATGAACATGA AAATGGAATCCATCGGGAAAGTTAGGGGAAA