SSO2306

Coordinates:2109632-2110384

>SSO2306 precorrin-3B C17-methyltransferase
MKMGRLYIVGIGPGSKEQRTIKAQEVLEKSNVIIGYNTYLRLISDVLDGKKEVIGARMKEEIFRANTAIEKALESNNTVA
LVSSGDPQVYGMAGLVYDLIARRNLDLDVEVVPGVTAALAAAARLGSPLSLDFVVISLSDLLIPREEILHKVTKAAEADF
VIVFYNLINENLLIEVMDIISKHRKPNTPVGLVKSAYRNNENIIITTLSSWKEYMNEISMSTTMIIGNSLTYRYKNYMIT
PRGYERKYEL

>SSO2306 precorrin-3B C17-methyltransferase
ATGAAAATGGGGAGGTTATATATTGTTGGAATCGGACCAGGATCAAAAGAACAAAGGACAATTAAGGCGCAAGAAGTTCT
GGAAAAGTCCAATGTAATAATTGGATATAATACATACTTAAGGTTAATATCGGATGTCCTAGATGGCAAAAAGGAAGTAA
TAGGGGCTAGAATGAAAGAGGAAATATTTAGGGCAAATACTGCAATAGAAAAGGCCTTAGAGTCCAATAATACAGTAGCC
TTAGTATCTAGTGGTGACCCCCAGGTCTACGGAATGGCGGGTTTAGTTTACGACTTGATTGCAAGGAGAAATTTAGATTT
AGACGTCGAAGTGGTACCAGGTGTAACTGCTGCATTAGCAGCCGCTGCGAGATTAGGAAGTCCCCTTTCTCTTGACTTTG
TAGTAATAAGCTTAAGCGATTTACTAATCCCACGAGAGGAGATTTTACATAAAGTAACTAAGGCTGCTGAAGCTGACTTT
GTAATAGTATTTTATAATTTAATTAATGAGAATTTACTAATAGAGGTTATGGATATAATTTCAAAACATAGAAAGCCAAA
TACCCCAGTGGGACTAGTCAAGAGCGCGTATAGGAATAATGAGAACATAATAATTACGACTTTATCGTCATGGAAAGAAT
ATATGAATGAAATAAGTATGAGTACTACAATGATAATAGGAAACTCATTGACATATAGATATAAAAATTACATGATAACA
CCAAGAGGTTACGAGAGGAAATATGAGCTATGA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2109132 - 2110884 (Additional range around SSO2306 is :500nt.)

>Sulfolobus solfataricus P2 AGAAAAGAATAATTGGTAAGGCCATTTTTGCGTCTGGAAATCCGGAATTAGCCAGATATTTAAAGCTAACTAATTTAGAT GCAGGGATTGAGGCAATAAAAGCTGGAAGTGAAATCGTGGCTGATGTGAAAATGGTTTCTGTAGGTATAAGATGGAGAAA GGTTACTTGTATGATAGATAATGAGAGAACGAAGGAGTTATCAAAGGAATTAGGAATAACCAGAGCAGCAGCCGCTATGA GATTATCAATTGGACAAGGTGGTAAGGTAGTAGTTATAGGAAACGCTCCTACTGCACTTATGGAAACGATTAAATTAGTT AAAGAAGGAATTGATATACCGTTTATAGTAGCAACACCCCCTGGTTTCACTAACGCTAAAGAGTCAAAGGAGGCGTTAAT AGAGACTAAAATTCCATCTGTAGTATTAACTGGAACTTATGGTGGGAGTGGAATAGCAGTGGCGATTATTAATGAGATTA TCAAAATGGCAATGGAGGG ATGAAAATGGGGAGGTTATATATTGTTGGAATCGGACCAGGATCAAAAGAACAAAGGACA ATTAAGGCGCAAGAAGTTCTGGAAAAGTCCAATGTAATAATTGGATATAATACATACTTAAGGTTAATATCGGATGTCCT AGATGGCAAAAAGGAAGTAATAGGGGCTAGAATGAAAGAGGAAATATTTAGGGCAAATACTGCAATAGAAAAGGCCTTAG AGTCCAATAATACAGTAGCCTTAGTATCTAGTGGTGACCCCCAGGTCTACGGAATGGCGGGTTTAGTTTACGACTTGATT GCAAGGAGAAATTTAGATTTAGACGTCGAAGTGGTACCAGGTGTAACTGCTGCATTAGCAGCCGCTGCGAGATTAGGAAG TCCCCTTTCTCTTGACTTTGTAGTAATAAGCTTAAGCGATTTACTAATCCCACGAGAGGAGATTTTACATAAAGTAACTA AGGCTGCTGAAGCTGACTTTGTAATAGTATTTTATAATTTAATTAATGAGAATTTACTAATAGAGGTTATGGATATAATT TCAAAACATAGAAAGCCAAATACCCCAGTGGGACTAGTCAAGAGCGCGTATAGGAATAATGAGAACATAATAATTACGAC TTTATCGTCATGGAAAGAATATATGAATGAAATAAGTATGAGTACTACAATGATAATAGGAAACTCATTGACATATAGAT ATAAAAATTACATGATAACACCAAGAGGTTACGAGAGGAAATATGAGCTATGA TAATAAACTCTTTGAAGAGATTTGGA ATAACCACTGGAGCGGCAGCCTCTGCAGCCGCAAAGGCAGCAGTTATAGGTCTACTTAATAAGGAGAAAAGAAGTACAGT AGTAATACCAACACCCATAGGATTGAGACTGGAAATTCCCGTGGAAAAAGTTGAGATAGATAGTGAAATATCGTGCGCTG AGGTTAAGAAATTTTCCGGAGATAATCCGGATATATTAGATGGATTAGTAATAAGGTGCTGTGCTAAATTGAATGAGAAT AATGAAATTGTAATAATTGGAGAAAGGGGAGTTGGTAAAGTTACTAGAAGTGGGTTAAAAGCAACTATGGGTGAGATGGC AATAAGTCCTACTGTAAGAGAAATGATAATCAACGCAATAAGGGAAGTTACAGATAAGGGAATACAAATAACGATCGAAG TGCCAAATGGAGAGACCATTGCTGAAAAGACATTAAACAAAATGGTCGGAATAGTCGGTGGGATTTCCATACTC