SSO2324

Coordinates:2124780-2125265

>SSO2324 hypothetical protein SSO2324
MAPIFLEYKVVHDNITYYIIYVFIYNLSLKLVTMYTINPSSHTILNYNVSLEPEQIFSNITGVSTYYSLDGKKILAYEDN
NGSIIVAYNGLILKKASNNSVRYLIAANYPGIDNSKFPSLYKLAEISIFDSNIRVLVLGVLLTILSSFILKVMVGRYDKV
R

>SSO2324 hypothetical protein SSO2324
ATGGCTCCTATCTTTCTAGAATACAAGGTTGTACATGATAATATTACATATTATATTATTTATGTTTTTATATATAATTT
ATCATTAAAGTTAGTAACAATGTATACAATAAATCCAAGTTCTCATACAATTCTTAACTATAATGTATCTTTAGAGCCCG
AACAAATTTTTTCAAATATCACTGGAGTATCTACATATTATAGCTTAGATGGAAAAAAGATTCTTGCTTACGAAGACAAC
AACGGTAGTATAATCGTAGCATATAACGGGTTAATTCTGAAAAAGGCTAGCAATAACTCTGTTCGTTATCTCATAGCTGC
TAACTATCCTGGAATTGATAACAGTAAATTTCCTAGTCTTTATAAGCTAGCTGAAATCTCCATTTTTGATTCTAATATAA
GGGTCCTAGTTTTAGGGGTTTTACTAACTATTTTGTCATCCTTCATCCTAAAGGTTATGGTGGGACGATATGATAAGGTT
AGATAA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2124280 - 2125765 (Additional range around SSO2324 is :500nt.)

>Sulfolobus solfataricus P2 ATATATATTTGAGTACGTCACTCCTTCTGCAGATGCAGTAAACGAGATGGCTGTAGTAGTGGGCGACAATTCCACGCTAG AAACTCCAGAACTTGGAGATACTGTAAAGTATATCCAGTAGCTTCTAGTATTTAATGGATAGTTAACAGCATATAGGACA GAGCCGGATAGTGTTAGTGCTGTTGACGCTGTCTCCTCTCCTTTATTTATAGTGGATTTGGCTTTCTGTGTCACAAATAA TCCCATATTTATAGCCACGTAAGCTAATACTGATGCAGTTATTATAAATGCTATTAATATTATTGCAGTGTCTAATCCCG CTAATCCTTTCCTTTTCACTTTTTTGTTGTATTCCTTTAACATCTTTTTGGAGTTCATTTTTTGGTCACTTGCTGAAATC CGTTTCTCAGAACACTTTTAAAAATCTCTCTCTGATTTTCGACTACAGGTCGACATAACTTTAGGCTATTTTTTAAGTAA CTGTTAGCAAGTAATATTTA ATGGCTCCTATCTTTCTAGAATACAAGGTTGTACATGATAATATTACATATTATATTAT TTATGTTTTTATATATAATTTATCATTAAAGTTAGTAACAATGTATACAATAAATCCAAGTTCTCATACAATTCTTAACT ATAATGTATCTTTAGAGCCCGAACAAATTTTTTCAAATATCACTGGAGTATCTACATATTATAGCTTAGATGGAAAAAAG ATTCTTGCTTACGAAGACAACAACGGTAGTATAATCGTAGCATATAACGGGTTAATTCTGAAAAAGGCTAGCAATAACTC TGTTCGTTATCTCATAGCTGCTAACTATCCTGGAATTGATAACAGTAAATTTCCTAGTCTTTATAAGCTAGCTGAAATCT CCATTTTTGATTCTAATATAAGGGTCCTAGTTTTAGGGGTTTTACTAACTATTTTGTCATCCTTCATCCTAAAGGTTATG GTGGGACGATATGATAAGGTTAGATAA ACGTAACTTCATTCCTTGGATTTCTATAGTTCTTTTATTATGTGCCTACTCC ATAGGGACTGGCCTGTATATAACTATACAGCGTGTTACGTATTATCCTATATTTGAATCTAAAATTGTTTCAGTATTTCT TACAATATTCTCATCATCCTTGATTACTTTTTACAATTATAAGAAATATGTCTTTCTACTTCCGTTATCTCTATTGTCTT TCTTCTCTGTGTCGTTAACTCCCCTTATAATATCTATATTTATTTTATATGAGTTAAAGAAAGTTGACCGAACAGTTAGT ATTATATTGCTAATAATAAATGCTTCCATGATATCATGGCTTATTCTACGTTTACTATTAGGCATTAATACTTACTTTTC TATTCCTCTAATGATTTTAGAAGCGGGAGCACCTACGGTAATTCCATTTATATGGTTTGTTGGAATAATATTATCTGCTT ATAAAAGAAATTTAAGTAGTAAAAGCCAACTATTTATCAATCCCTTA