SSO2355

Coordinates:2149856-2150650

>SSO2355 Phosphatase, putative (nagD-like)
MSVLNGYQLIISDVDGVIVREGDPIWENIQALRNIQNNGVKIIFVTNNSGFSRILLSRQLSYLGLKVTPDMIITSGLAAA
IYMKEKLNVKSVFAVGEEGLIEELKNHGFLVFSSAESERILPDAVVMGLDRLSTYDKLSLAMRCISKGSKFIVTNMDRLW
PAKDGLKLGAGALASSIIYALRRDPDFIAGKPNTWIVEIAMRISNVKKLDKILVIGDQIETDIQMGYNIGADTALVLTGI
SNVDDVDRSNVKPKYVVNTLLDLL

>SSO2355 Phosphatase, putative (nagD-like)
ATGTCAGTACTTAACGGCTATCAATTAATAATAAGTGATGTAGATGGGGTAATAGTAAGAGAAGGAGATCCAATATGGGA
GAATATTCAAGCGCTAAGGAATATACAAAATAACGGAGTTAAGATCATATTTGTAACAAACAACTCTGGTTTTAGTAGGA
TCTTATTATCTAGGCAGTTATCATACTTAGGCCTTAAAGTTACCCCAGATATGATAATTACAAGTGGTTTAGCTGCAGCA
ATTTATATGAAAGAAAAACTCAATGTCAAATCAGTATTCGCAGTAGGCGAAGAGGGCCTTATTGAAGAATTGAAAAATCA
CGGTTTTTTAGTATTCTCAAGCGCAGAATCAGAGAGAATTTTACCAGACGCGGTCGTAATGGGATTAGATAGGTTAAGTA
CCTATGATAAACTGTCGTTAGCCATGAGGTGCATAAGCAAAGGATCGAAATTTATAGTAACAAATATGGACAGGCTTTGG
CCAGCTAAGGATGGATTAAAATTGGGTGCCGGTGCGTTAGCTAGTTCTATAATTTACGCGTTAAGAAGGGATCCGGACTT
CATAGCTGGGAAACCTAATACTTGGATAGTAGAAATAGCCATGCGGATTTCTAATGTTAAGAAGTTAGATAAGATTCTAG
TTATAGGAGATCAAATAGAGACTGATATCCAGATGGGGTACAATATAGGTGCCGACACTGCATTAGTCTTAACTGGAATA
TCAAACGTAGATGATGTTGATAGGAGTAATGTTAAGCCGAAATATGTAGTAAATACTTTATTAGACCTTTTGTGA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2149356 - 2151150 (Additional range around SSO2355 is :500nt.)

>Sulfolobus solfataricus P2 TATTCTTAAAAATTATTATCAAGAGAATTGAATAGAGCACAAACGAAAATAGATAATCGAAAGTGAGTTGGAAACTCCTT AACAGTATAAGCAATGATTCTACTGAAAAAGTTGTTGCAAATATTTTTATACTAGGCAGAGTTTTAAGATAACCATAGTA TTTCCTTGTCAAATTTTCAGTATCCATGTCCATGATAAGTTGATGGGGTGAAATAAAATAGTTTTGTCAATTAATAAGGA AAAACTAGGTGCAGACAAGGTAATAAAAAATTCGTTAGACTATTGCGATTTATATATCATACAAAAAGGTGATAAAGTGT TTCTTCTATACCTATTTGAGAGACGAGGATACTATTATTTCAAAATAATGCCGGAAATTGTCGGAAAATGGGAAGATTGT GAAAACGTAGTCTATACTGCATTTGGGCTTTTTGGTTTTGTAAGTAACCAAGAAGAATTAGAGCAAAAAATTAAAGAGAA GATTGAGGTGTTAATGCGAA ATGTCAGTACTTAACGGCTATCAATTAATAATAAGTGATGTAGATGGGGTAATAGTAAG AGAAGGAGATCCAATATGGGAGAATATTCAAGCGCTAAGGAATATACAAAATAACGGAGTTAAGATCATATTTGTAACAA ACAACTCTGGTTTTAGTAGGATCTTATTATCTAGGCAGTTATCATACTTAGGCCTTAAAGTTACCCCAGATATGATAATT ACAAGTGGTTTAGCTGCAGCAATTTATATGAAAGAAAAACTCAATGTCAAATCAGTATTCGCAGTAGGCGAAGAGGGCCT TATTGAAGAATTGAAAAATCACGGTTTTTTAGTATTCTCAAGCGCAGAATCAGAGAGAATTTTACCAGACGCGGTCGTAA TGGGATTAGATAGGTTAAGTACCTATGATAAACTGTCGTTAGCCATGAGGTGCATAAGCAAAGGATCGAAATTTATAGTA ACAAATATGGACAGGCTTTGGCCAGCTAAGGATGGATTAAAATTGGGTGCCGGTGCGTTAGCTAGTTCTATAATTTACGC GTTAAGAAGGGATCCGGACTTCATAGCTGGGAAACCTAATACTTGGATAGTAGAAATAGCCATGCGGATTTCTAATGTTA AGAAGTTAGATAAGATTCTAGTTATAGGAGATCAAATAGAGACTGATATCCAGATGGGGTACAATATAGGTGCCGACACT GCATTAGTCTTAACTGGAATATCAAACGTAGATGATGTTGATAGGAGTAATGTTAAGCCGAAATATGTAGTAAATACTTT ATTAGACCTTTTGTGA AATTGTAGAAAGAATACTTAAAAACTATTACGCAAATATAAACATGTATGGAAAAGATCGAAT ACGACGCTGTTGTAATTGGAGGAGGACTAGCAGGATTAATGAGTGCACATGAGATAGCCTCTGCTGGTTTTAAAGTTGCT GTTATTTCAAAGGTATTTCCCACGAGATCGCATTCTGCAGCAGCAGAAGGTGGAATAGCAGCCTATATTCCTGGGAATTC AGATCCAAATGATAACCCAGATTATATGACATACGATACAGTTAAAGGCGGAGATTATTTAGTTGATCAAGATGCAGCGG AATTACTTTCCAACAAATCTGGAGAAATAGTAATGTTACTAGAAAGATGGGGTGCACTATTCAATAGGCAACCGGATGGC AGAGTTGCAGTCAGGTATTTTGGAGGACAGACCTATCCGAGAACTAGATTTGTTGGAGACAAAACTGGAATGGCACTGTT ACATACACTTTTCGAAAGGACTTCTGGTTTAAATGT