SSO2523

Coordinates:2292023-2293702

>SSO2523 acyl-CoA synthase
MNQSILYDRPWFKYWPPRLPKTLDYPKVPLFNIVEVSSQRYPNKTAIIYYGNRITYKELWESIIKFSAFLSNKLGVRKGD
RIALFMPNSIQWIIAYFGILRANAILVPINPLLAEDELNYILKDSGSVGVVTLSSYLSKVMKAKENTQVKWVIAGRFKDY
LPDNPEIKVHPLMLREPELSNDVIPWKETLRNNYTPPSVEVDAEDIAVIPYTSGTTGVPKGCIHTHSTIWPTILGSVIWN
TLAPSAVVLTSLPVFHVTGFIHSLNAPLYVGSTMVLLSIWDREAALDAIAKYRVTHWTNISTMVVDLLATPGIEKRDLSS
LMLVGGGGAPMPEAVARKLKELTGLDYIEGYGLTETMSQTHVNPPQRPKLQCLGIPHFGVDALIIDPSTGEVLPPNREGE
IVVRCPSLFKGYWNKEEETRKSFITINGLEYFRTGDLGYMDDEGYFFILDRVKRMINRAGYKVWPTKVENKLYQHPAVLE
ACVVATPDPRVNEEVKAYIVLKPEYKGKITADEIREWCKQHMSAYEYPRIIEFVDSLPKSGSGKILWRVLQEKEKGANK

>SSO2523 acyl-CoA synthase
ATGAATCAAAGTATATTATATGATAGACCCTGGTTTAAATACTGGCCACCTAGATTACCAAAGACCTTAGATTACCCAAA
AGTTCCCCTATTCAATATTGTTGAGGTCTCTTCACAGAGATATCCTAATAAAACTGCCATAATATATTATGGTAATAGAA
TAACGTATAAGGAGTTATGGGAAAGTATAATCAAGTTTTCAGCATTTCTAAGTAATAAGCTTGGAGTAAGAAAAGGAGAT
AGAATAGCATTATTTATGCCGAATTCGATACAGTGGATCATAGCCTATTTTGGAATCCTAAGGGCTAATGCAATATTGGT
TCCAATAAATCCATTATTAGCAGAAGATGAGCTCAACTACATCCTTAAGGACTCTGGATCGGTTGGAGTGGTGACCTTAT
CCTCATATCTTAGCAAGGTAATGAAAGCCAAAGAGAATACTCAAGTTAAATGGGTTATTGCGGGTAGGTTTAAGGACTAT
CTTCCAGATAACCCAGAAATAAAGGTTCATCCACTGATGCTTAGGGAACCAGAGTTAAGTAATGACGTAATCCCTTGGAA
GGAAACTTTAAGAAACAATTATACCCCTCCATCAGTTGAAGTAGATGCAGAAGATATTGCAGTGATTCCATACACTTCAG
GTACAACGGGAGTTCCAAAGGGTTGTATTCACACCCATTCAACCATATGGCCTACGATTTTAGGTTCAGTTATCTGGAAC
ACATTGGCACCTTCCGCAGTAGTCCTAACGTCCTTACCCGTATTTCATGTGACTGGTTTTATTCATAGCTTGAACGCTCC
ATTATATGTTGGGAGTACAATGGTTTTACTGTCTATTTGGGATAGGGAGGCAGCCTTAGATGCGATAGCGAAGTACAGAG
TTACCCATTGGACTAACATATCCACAATGGTCGTAGACTTGTTAGCGACACCAGGCATAGAAAAGAGAGATCTGAGTTCC
CTAATGTTAGTAGGAGGAGGAGGTGCTCCAATGCCTGAGGCTGTTGCTAGAAAGTTAAAGGAGTTAACTGGATTAGATTA
TATAGAGGGTTATGGATTAACCGAAACTATGTCTCAAACTCACGTTAATCCTCCACAGAGGCCTAAGTTACAGTGTCTAG
GGATTCCACATTTTGGAGTTGACGCTTTAATAATAGATCCATCAACTGGCGAAGTGCTTCCACCTAATAGAGAGGGGGAA
ATAGTAGTTAGATGTCCCAGTTTATTTAAGGGTTATTGGAATAAGGAGGAGGAAACTAGGAAGTCGTTTATAACTATAAA
TGGTTTAGAGTATTTCAGAACTGGAGATCTCGGATATATGGACGATGAGGGGTATTTCTTTATCCTTGATAGGGTAAAGA
GAATGATAAATAGGGCAGGTTACAAGGTATGGCCGACCAAAGTAGAAAATAAGTTATACCAGCATCCGGCAGTTTTAGAA
GCGTGCGTAGTTGCAACACCAGATCCAAGGGTCAATGAGGAAGTTAAGGCATATATAGTACTAAAGCCAGAATATAAGGG
AAAAATAACTGCTGATGAAATAAGGGAGTGGTGTAAACAACATATGAGTGCTTATGAATACCCCAGAATTATAGAATTCG
TTGATTCATTGCCGAAAAGTGGATCTGGGAAAATATTATGGAGAGTGCTTCAAGAGAAAGAAAAAGGAGCTAATAAGTAA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2291523 - 2294202 (Additional range around SSO2523 is :500nt.)

>Sulfolobus solfataricus P2 TCTGCAGCTATCTTTACGAAGCCAGCTTTATTGAGAGTACCTTGTATTCCCTCTTTTATATCATGAATAAACAAGTCAGC TATCTCATCAATTGACCTATTTAAGAAATAGAAAGGTAAGTCGATATATATGTAAATCCCCGTCCCCGCAACTAAATTTA TCCCGGTAGCCTTAACCACTTTTTCCATAAATCTGATGTCCCTACCCAATCCCATTACAGTGGGATCTACTATAGTCTTT ACTCCAAATTGCATTGCCCTTTTAACCTCATTTACAGCGTTTCTGAACTCCTCATCTTCGTTATATAGATGGGGCCATTG TTGTCTGACCGCTTCGCTAAAAACTCTTAAATGTTCATGAATTAGCGTAAATCCTATGTCCTTAGATTCTATTGAATCTT TCCCAACTAATGGTATTCTCATATACTAGTCTATTTTATCCATAGTAGATAAGCTTTTCTGTGAATAAAGGTTTATTAGT GCATATATCTAAATTTTCCT ATGAATCAAAGTATATTATATGATAGACCCTGGTTTAAATACTGGCCACCTAGATTACC AAAGACCTTAGATTACCCAAAAGTTCCCCTATTCAATATTGTTGAGGTCTCTTCACAGAGATATCCTAATAAAACTGCCA TAATATATTATGGTAATAGAATAACGTATAAGGAGTTATGGGAAAGTATAATCAAGTTTTCAGCATTTCTAAGTAATAAG CTTGGAGTAAGAAAAGGAGATAGAATAGCATTATTTATGCCGAATTCGATACAGTGGATCATAGCCTATTTTGGAATCCT AAGGGCTAATGCAATATTGGTTCCAATAAATCCATTATTAGCAGAAGATGAGCTCAACTACATCCTTAAGGACTCTGGAT CGGTTGGAGTGGTGACCTTATCCTCATATCTTAGCAAGGTAATGAAAGCCAAAGAGAATACTCAAGTTAAATGGGTTATT GCGGGTAGGTTTAAGGACTATCTTCCAGATAACCCAGAAATAAAGGTTCATCCACTGATGCTTAGGGAACCAGAGTTAAG TAATGACGTAATCCCTTGGAAGGAAACTTTAAGAAACAATTATACCCCTCCATCAGTTGAAGTAGATGCAGAAGATATTG CAGTGATTCCATACACTTCAGGTACAACGGGAGTTCCAAAGGGTTGTATTCACACCCATTCAACCATATGGCCTACGATT TTAGGTTCAGTTATCTGGAACACATTGGCACCTTCCGCAGTAGTCCTAACGTCCTTACCCGTATTTCATGTGACTGGTTT TATTCATAGCTTGAACGCTCCATTATATGTTGGGAGTACAATGGTTTTACTGTCTATTTGGGATAGGGAGGCAGCCTTAG ATGCGATAGCGAAGTACAGAGTTACCCATTGGACTAACATATCCACAATGGTCGTAGACTTGTTAGCGACACCAGGCATA GAAAAGAGAGATCTGAGTTCCCTAATGTTAGTAGGAGGAGGAGGTGCTCCAATGCCTGAGGCTGTTGCTAGAAAGTTAAA GGAGTTAACTGGATTAGATTATATAGAGGGTTATGGATTAACCGAAACTATGTCTCAAACTCACGTTAATCCTCCACAGA GGCCTAAGTTACAGTGTCTAGGGATTCCACATTTTGGAGTTGACGCTTTAATAATAGATCCATCAACTGGCGAAGTGCTT CCACCTAATAGAGAGGGGGAAATAGTAGTTAGATGTCCCAGTTTATTTAAGGGTTATTGGAATAAGGAGGAGGAAACTAG GAAGTCGTTTATAACTATAAATGGTTTAGAGTATTTCAGAACTGGAGATCTCGGATATATGGACGATGAGGGGTATTTCT TTATCCTTGATAGGGTAAAGAGAATGATAAATAGGGCAGGTTACAAGGTATGGCCGACCAAAGTAGAAAATAAGTTATAC CAGCATCCGGCAGTTTTAGAAGCGTGCGTAGTTGCAACACCAGATCCAAGGGTCAATGAGGAAGTTAAGGCATATATAGT ACTAAAGCCAGAATATAAGGGAAAAATAACTGCTGATGAAATAAGGGAGTGGTGTAAACAACATATGAGTGCTTATGAAT ACCCCAGAATTATAGAATTCGTTGATTCATTGCCGAAAAGTGGATCTGGGAAAATATTATGGAGAGTGCTTCAAGAGAAA GAAAAAGGAGCTAATAAGTAA ATGAATAAAATATTATCATTTTGTTTCTTTATTGGTATCAATACTAACTATATTAATA GGATAATTTCGAAGAAATACAATTTATTATATGATTTATGTTAGGCTCAGCTATTCTTCTAATATTCTCCTCCCCTAAAA GTCTAGATAACATCCCGAGATTTATCTTGGCAAACCAATTCACTCTAGTTATCCCTTCATCTTTCTTCAATCCCAAGATA ATGTTAAATTTTATTCCCACCCCTGCTGATCTACCGTCACCGTTTATCTCTACACTATTCTCTTTTTCAATGATATTGGC ATTTATGGAAGCGGTTAATGTAGTCATATGAGGTATTTTCATTTGTGACACATCTAGTTTAAAAATTGCCTTAAATACAT TATTATTTGTCTCATAGCTCTGCAATCCAGTTAGGCATTCAGCGAACTGTTTTGGATTAATTAAAAATCCCTTGACGGCC TCTATAGTTCTCTTTACATCAAAAGTTCCCTTAAACTCCAT