SSO2679

Coordinates:2438416-2440404

>SSO2679 hypothetical protein SSO2679
MVIRVTERRVKLASIISYDFLFLVLLSGLLNLIITIFRERLLYVLSSFFQYIVSNPSVALGDALGFIFVLQALLLGLFIG
GIVILSISFTINLTRIRSEYEEGVPLSTILRSRIITSSRLGIIANWISERSKRYINASADLESPTEVGVRYVAYFLVSLL
VVIPVSLALSIALLSPLPFLLIFFPLTFIFYPEQKYKSRAREIRDDIQDEIPFFVTLITIINASGTTIYEGMRKILQFPI
FKAMKKEALLIIRDIEFFGKSPLDALEHRSRLTLNRDYSWFLAGYSSIIRSGGDIEAYLFQKAREFLNWLQFRWRFYSER
TSFLGELIVILFLIFPMFLIALAFFTSGAVISFLLIIPILFGTILYTITANNRPRYMDSIGLTKLQLLIGFIAALLTAGV
IEIFLDEIYYAIGLGLLSFSLASTIFMYNQIREINDVENSLPQFLRDITEFRKIGYDLSRAIKTLAEEKRYRREFNRVLN
EITKQDSMGIPITRAKINTRSWLGKFSLTTVQILIESGAVRPDLLEYLTEFTLNFIQSKKEAFSRMRAYQVLGILTPLLL
IATILIAIVIIDSFTIVTLPTNTVGLPQFPNIISQFILSPVILAEMFIFILMSTFAIGLLVTKALYGTVQYMIMPAIGLT
LAVLSIHFFSVIEPIILKFFSI

>SSO2679 hypothetical protein SSO2679
ATGGTGATAAGAGTGACTGAGAGAAGAGTTAAATTAGCTAGTATAATCTCATACGATTTCTTATTTCTAGTTTTACTATC
AGGCTTACTAAACTTAATTATTACAATATTTAGAGAACGTCTCCTATATGTGCTTTCTAGTTTTTTCCAATATATCGTGA
GTAACCCTTCGGTAGCACTTGGGGATGCGTTGGGTTTTATATTCGTTCTTCAAGCATTACTTCTAGGCCTATTTATTGGA
GGAATAGTTATTTTAAGTATAAGCTTTACAATAAATTTGACGCGAATAAGGAGTGAATATGAAGAGGGCGTTCCATTATC
AACCATTCTAAGGTCTAGGATAATTACAAGTAGTAGATTAGGTATCATAGCAAATTGGATAAGTGAGCGTAGTAAGAGAT
ATATTAACGCGAGTGCTGATTTGGAAAGTCCTACTGAGGTTGGCGTTAGATACGTTGCATATTTTTTAGTCTCATTACTT
GTCGTAATACCGGTATCATTAGCACTTAGTATAGCATTACTCTCTCCTCTACCATTTCTATTAATATTTTTTCCGTTAAC
TTTTATCTTTTATCCAGAACAGAAATACAAGAGTAGGGCTAGAGAAATAAGAGACGATATTCAAGATGAGATACCTTTCT
TTGTGACTCTAATCACTATCATTAATGCAAGTGGTACAACCATATATGAGGGAATGAGAAAAATTTTACAATTTCCAATA
TTTAAAGCTATGAAAAAGGAGGCATTACTCATTATAAGGGATATAGAATTCTTTGGAAAATCCCCGCTAGATGCTCTGGA
GCATAGATCTCGATTAACACTAAATAGAGATTACTCTTGGTTTTTAGCTGGCTATTCTTCGATCATAAGAAGTGGTGGCG
ATATTGAAGCATATTTGTTCCAAAAGGCTAGAGAGTTTCTCAATTGGCTCCAATTCCGTTGGAGGTTTTACTCTGAAAGG
ACTTCGTTCCTAGGAGAGTTAATAGTGATCTTATTCCTTATTTTCCCCATGTTCTTAATTGCATTAGCCTTCTTCACAAG
TGGTGCAGTTATATCATTTTTGCTCATAATACCTATATTATTTGGTACAATATTATATACAATTACAGCTAATAATAGAC
CTAGATATATGGATAGTATAGGTCTCACCAAGTTACAGTTACTAATAGGATTTATCGCTGCATTATTAACAGCAGGGGTA
ATCGAAATATTTCTTGATGAAATATATTACGCAATTGGTTTAGGGCTCTTATCGTTCTCTCTAGCATCAACAATATTCAT
GTATAACCAAATAAGAGAAATTAACGATGTTGAAAACTCGTTACCGCAATTTCTAAGAGATATTACAGAGTTCAGAAAGA
TAGGTTACGATCTAAGTAGGGCTATTAAGACATTGGCCGAGGAAAAGAGATATAGAAGGGAGTTTAATAGGGTACTAAAT
GAAATAACAAAACAAGATTCCATGGGGATTCCAATAACTAGAGCTAAGATAAATACTAGAAGCTGGTTGGGTAAGTTCTC
TCTTACCACTGTCCAGATACTAATAGAAAGCGGTGCTGTAAGACCAGATCTACTGGAGTATTTAACTGAATTTACACTTA
ATTTTATACAATCAAAGAAGGAGGCATTCTCAAGAATGAGAGCTTATCAAGTTTTAGGAATTCTAACACCACTCCTTCTA
ATAGCTACAATACTTATAGCTATTGTGATTATTGACTCATTCACAATAGTAACTTTACCGACAAATACCGTAGGTTTACC
ACAATTCCCAAACATCATTAGTCAATTTATTTTATCTCCGGTGATACTTGCTGAAATGTTCATATTCATTTTAATGTCAA
CTTTTGCCATAGGATTACTGGTAACTAAAGCACTATATGGCACTGTACAATACATGATAATGCCAGCAATTGGATTAACC
CTAGCAGTGCTCTCAATACACTTCTTCAGCGTAATAGAACCGATAATCTTGAAATTCTTCTCGATATAA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2437916 - 2440904 (Additional range around SSO2679 is :500nt.)

>Sulfolobus solfataricus P2 TACAGACCAGATTACATTATAGTGGGGGAAGTTAGAGGTAAGGAAATAGAATGGTTAGTTCAAGCTGTCGCCAGTGGTCA TGGTGGACTTACAACCTTTCACGGATCTAATCATACTGACCTAATAACAAGAATTAGCGGATTATTAGGTCCAGAGCTCT CATTACAATTCAAACAACTAATTTCAGTAATCGCAATCATAAAAAGAATTGAAACTGAGGATAGAAAGATGAATAGGAAA ATGATATCTATCGTCGAAAATGATGGAAATGGATTTAGGGAAGTATTTAGATATGACTATGAAAGAAAGAACTTTGTTCC AGATAATTTAAAAGAAATTACTAGTATACAGCTAGAAAGATCTAGAGAACTATTAGGCTGGAGTAGGGATAAGTTGTATA GGGAGATTGAAAACAGATTACTACTAATAAGAGGGCTTGCCGAAAAGGGAGTTTATGACTATGACACATTAGCAAGAGAG TTAGTCAAGTATTATACAA ATGGTGATAAGAGTGACTGAGAGAAGAGTTAAATTAGCTAGTATAATCTCATACGATTTC TTATTTCTAGTTTTACTATCAGGCTTACTAAACTTAATTATTACAATATTTAGAGAACGTCTCCTATATGTGCTTTCTAG TTTTTTCCAATATATCGTGAGTAACCCTTCGGTAGCACTTGGGGATGCGTTGGGTTTTATATTCGTTCTTCAAGCATTAC TTCTAGGCCTATTTATTGGAGGAATAGTTATTTTAAGTATAAGCTTTACAATAAATTTGACGCGAATAAGGAGTGAATAT GAAGAGGGCGTTCCATTATCAACCATTCTAAGGTCTAGGATAATTACAAGTAGTAGATTAGGTATCATAGCAAATTGGAT AAGTGAGCGTAGTAAGAGATATATTAACGCGAGTGCTGATTTGGAAAGTCCTACTGAGGTTGGCGTTAGATACGTTGCAT ATTTTTTAGTCTCATTACTTGTCGTAATACCGGTATCATTAGCACTTAGTATAGCATTACTCTCTCCTCTACCATTTCTA TTAATATTTTTTCCGTTAACTTTTATCTTTTATCCAGAACAGAAATACAAGAGTAGGGCTAGAGAAATAAGAGACGATAT TCAAGATGAGATACCTTTCTTTGTGACTCTAATCACTATCATTAATGCAAGTGGTACAACCATATATGAGGGAATGAGAA AAATTTTACAATTTCCAATATTTAAAGCTATGAAAAAGGAGGCATTACTCATTATAAGGGATATAGAATTCTTTGGAAAA TCCCCGCTAGATGCTCTGGAGCATAGATCTCGATTAACACTAAATAGAGATTACTCTTGGTTTTTAGCTGGCTATTCTTC GATCATAAGAAGTGGTGGCGATATTGAAGCATATTTGTTCCAAAAGGCTAGAGAGTTTCTCAATTGGCTCCAATTCCGTT GGAGGTTTTACTCTGAAAGGACTTCGTTCCTAGGAGAGTTAATAGTGATCTTATTCCTTATTTTCCCCATGTTCTTAATT GCATTAGCCTTCTTCACAAGTGGTGCAGTTATATCATTTTTGCTCATAATACCTATATTATTTGGTACAATATTATATAC AATTACAGCTAATAATAGACCTAGATATATGGATAGTATAGGTCTCACCAAGTTACAGTTACTAATAGGATTTATCGCTG CATTATTAACAGCAGGGGTAATCGAAATATTTCTTGATGAAATATATTACGCAATTGGTTTAGGGCTCTTATCGTTCTCT CTAGCATCAACAATATTCATGTATAACCAAATAAGAGAAATTAACGATGTTGAAAACTCGTTACCGCAATTTCTAAGAGA TATTACAGAGTTCAGAAAGATAGGTTACGATCTAAGTAGGGCTATTAAGACATTGGCCGAGGAAAAGAGATATAGAAGGG AGTTTAATAGGGTACTAAATGAAATAACAAAACAAGATTCCATGGGGATTCCAATAACTAGAGCTAAGATAAATACTAGA AGCTGGTTGGGTAAGTTCTCTCTTACCACTGTCCAGATACTAATAGAAAGCGGTGCTGTAAGACCAGATCTACTGGAGTA TTTAACTGAATTTACACTTAATTTTATACAATCAAAGAAGGAGGCATTCTCAAGAATGAGAGCTTATCAAGTTTTAGGAA TTCTAACACCACTCCTTCTAATAGCTACAATACTTATAGCTATTGTGATTATTGACTCATTCACAATAGTAACTTTACCG ACAAATACCGTAGGTTTACCACAATTCCCAAACATCATTAGTCAATTTATTTTATCTCCGGTGATACTTGCTGAAATGTT CATATTCATTTTAATGTCAACTTTTGCCATAGGATTACTGGTAACTAAAGCACTATATGGCACTGTACAATACATGATAA TGCCAGCAATTGGATTAACCCTAGCAGTGCTCTCAATACACTTCTTCAGCGTAATAGAACCGATAATCTTGAAATTCTTC TCGATATAA ACGTTTATATTTTCTCTTTTCCTATTTTTTACTAATGCAAGATAGTTTAGGATTACTTGCAATAACTCTA GTGATCGTTTTGCTATTTTCTATTTTAATTGGAATAATAATCTTAAATCATGAGAATTTTACACAACTCTACAACATTCA GAGTAATATAAATGGCGAAATATTAAGTAAAGCTAAAGTAGGTTATTATTGGATCGTAGAGGAATTAAAAAATAAAACAA TTTCCTTCATACCTCATGTATATATACTAGACACCGAGGGTGTATATAACATTCAAAGCGTAGTTGAAACAACTTTTAAC GGCGAAATTTACACATTTCCAGTTAAAGATTTGCTAATCTTTACCAATGGTTCATTGAATAGGAATGGAGTAATTTTGAG TCCGGGGAATGTAATAATTATAAGACCGAATATAACTAGCGGACAATTAAGTTTCGTAACCAACACTGGAAATGCGTTCT CGTTGGCTTTACTTCCACCTTCAGATAGAA