SSO2696

Coordinates:2450493-2450816

>SSO2696 108 aa !not a gene!
MIMAIFIVLSNLTDKGAETIADKPERIKEVNEELAKIGAKVKEQYVVFGDIDFINIVEVDNVETFLKALIELNSRGTVRT
KTYLAISVDEAIRAIKTTPPIGHPHERK

>SSO2696 108 aa !not a gene!
ATGATAATGGCAATATTCATAGTTCTTTCTAACCTTACCGATAAGGGGGCTGAGACTATAGCAGATAAGCCAGAAAGAAT
AAAAGAGGTGAATGAGGAATTGGCTAAAATAGGGGCGAAAGTAAAGGAGCAATATGTAGTATTTGGTGATATAGATTTCA
TTAACATAGTAGAAGTGGATAATGTTGAAACGTTCCTTAAAGCCTTAATAGAATTGAATAGTAGAGGCACTGTAAGGACA
AAGACCTATTTAGCGATTTCTGTTGATGAAGCGATAAGGGCTATTAAAACCACACCACCTATTGGCCATCCGCATGAAAG
GAAG


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2449993 - 2451316 (Additional range around SSO2696 is :500nt.)

>Sulfolobus solfataricus P2 AATAATGAGGCTATGACAGATGTAACTTGTTTGGTATTCTTCTCAGACATCTTCTCGACTCCTAAGACTAATACAGTTTT AGTAATTTTAGAATCAAGTAGTGATTTAGCTACCAATATTGCAGAACCCCCACTTCCACTAGTATTATCGACCCTAATTG ATGGTACTTTATCTACTGATAAATAAGTTGTAATTAAATTATTTATCCCAGATAAGGAGTTAAACTCCCCAGAATAGCTG TTAGAAACTACTACAAAATCAATTTCGTATTTCCCTATTAATGGTAATGCAACCTCTCCAGCAAGCTCTAATAAGCTCTC CTTTCTCTTTCCGAATCGGGTTATGCTTGCGTCAATAATTGCAACCATTCATGTGAGATTCCACATTTAAAATATAAAAT TGAACTTCCAATAAAGAGAACATAAACTTCATTTCTAGAGCAAAAACAACAATAGTACTTGTTAATAAGAAATGTTTATA TTTTTTAAGAAAGAGTATA ATGATAATGGCAATATTCATAGTTCTTTCTAACCTTACCGATAAGGGGGCTGAGACTATA GCAGATAAGCCAGAAAGAATAAAAGAGGTGAATGAGGAATTGGCTAAAATAGGGGCGAAAGTAAAGGAGCAATATGTAGT ATTTGGTGATATAGATTTCATTAACATAGTAGAAGTGGATAATGTTGAAACGTTCCTTAAAGCCTTAATAGAATTGAATA GTAGAGGCACTGTAAGGACAAAGACCTATTTAGCGATTTCTGTTGATGAAGCGATAAGGGCTATTAAAACCACACCACCT ATTGGCCATCCGCATGAAAGGAAG TAATTCTCAAATATAATACATTTTTTGTTTCTCATACTGAGATAAGTATAACAAT CTTTCCTTTAGGGATGGATGCGTTCTAAATGAGAGAACGCTTTTTTCATCAACAATGTGATTTACAATGAACTCCTTAGC CAAGAATATCTGTATTGGGGGGACATATCTTAACATGTTAGTCGGAATACTTCTACTTAAATATCCAATTTTTATTAGGG AACTCTCCAACCAATAAGTTATATCAGGATTCACCTTTACTGCAGTTAAATCAGCCCTCTTTTCTATTTTCCTATGCACG TAAAAGACTGATGGCAATAAGATGACAAAGTATATTATTAGGAAAAATAGGGAAACTAAAGGCAGATAATAAATAAGCGC TGCATAAATGGAATTAATGGAAAATATTGTAAGTAACATAACTTCTGGATCGTAATTCTTTATATGGGCAATTTCATGAG AGAGAACTGCCGCTAACTCCTCTTGGACTAGACTTTCATACAGTG