SSO2823

Coordinates:2585494-2585937

>SSO2823 148 aa !not a gene!
MLILSEAMKPMESGPYLSLISFNLLAMYEIASSQLASLNLSPSLIKGLVILSELFTKSQPNLPFTQVRIPLAGDSGFGSI
FNIFLPLVQISNEQPTPQYIQTVLVFFICDSLALASISLKVINKLKLSSAFPIASIAFFFKSLLIQVR

>SSO2823 148 aa !not a gene!
TTGCTCATCTTATCTGAGGCTATGAAACCTATGGAATCTGGACCATATCTCTCCTTGATCTCCTTCAATCTTTTAGCTAT
GTACGAGATTGCCTCATCCCAACTAGCTTCCCTAAACTTATCACCCTCCCTTATTAAGGGCTTAGTAATTCTTTCCGAGC
TATTTACAAAATCCCAGCCGAATTTACCCTTTACGCAAGTTAGAATACCATTGGCTGGTGACTCAGGTTTTGGCTCAATT
TTTAATATTTTCCTACCCTTAGTCCAAATCTCAAATGAACAACCAACACCACAGTATATACAGACTGTTTTAGTTTTCTT
TATTTGTGATTCCCTAGCCTTAGCCTCTATCTCGCTAAAGGTCATTAATAAGCTAAAGTTATCCTCAGCTTTCCCTATAG
CCTCTATTGCTTTTTTCTTTAAATCCTTATTAATCCAAGTGAGA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2584994 - 2586437 (Additional range around SSO2823 is :500nt.)

>Sulfolobus solfataricus P2 TAATTATTTGATCTCTAGGGACACCAGTTATATCTTCAACGTAATCTAATGTAAATCCCTTTATAGATTCCTTAAACTCT TCAAAACCATTAACCCTCTTATCAATGAACTCTTTATCAATCCACCCCTGGTCAATAAGGTATTTAGCAACACCAGCTAA AACTGCTGCATCAGTTCCAGGCTTAGGTTTGATAAACAGGTCAGCCTTTTCAGCAATCTCATGTTTTCTAACGTCAATTA CCACGATCTTTGAACCGTTTATCTTTTTAGCTCTCTTTACCTTGCTTCCTATTACTGGATGACTCTCAGTTGTGTTGTGA CCAACAATTACAATCAAATTAGCGTTTTCGATATCCCTAATTGTTCCTGAATCTGCACCTATACCGACAGTTCTCCATAA CCCAACAGTTGCTGGAGATTGGCAATACCTTGCTGAATTATCTACATTATTAGTACCTATTATAGCTCTTGCTAGTTTCT GTAGTAAGTACGCCTCTTCA TTGCTCATCTTATCTGAGGCTATGAAACCTATGGAATCTGGACCATATCTCTCCTTGAT CTCCTTCAATCTTTTAGCTATGTACGAGATTGCCTCATCCCAACTAGCTTCCCTAAACTTATCACCCTCCCTTATTAAGG GCTTAGTAATTCTTTCCGAGCTATTTACAAAATCCCAGCCGAATTTACCCTTTACGCAAGTTAGAATACCATTGGCTGGT GACTCAGGTTTTGGCTCAATTTTTAATATTTTCCTACCCTTAGTCCAAATCTCAAATGAACAACCAACACCACAGTATAT ACAGACTGTTTTAGTTTTCTTTATTTGTGATTCCCTAGCCTTAGCCTCTATCTCGCTAAAGGTCATTAATAAGCTAAAGT TATCCTCAGCTTTCCCTATAGCCTCTATTGCTTTTTTCTTTAAATCCTTATTAATCCAAGTGAGA TAGCCAGCCTCTCC CAACATTGATTTTTCCATTAATGCGTTGACTGGACAAACAGTAACGCACGTACCACAATTTACGCATGAGGAGTTGCCTA TGGGATTTCCGTTATCCCAAACTACTCTTGGAGGATTGAGATCCCAATTAATCCATATTACCTCATTTACTGCAAAATCT TGGCAAGCCTCAACACATCTACCGCATAGGATACATTGTGATGGATCATATATGTAAAAGGGACCACTTTCATCCGTTTG ATAAGGCTTTTCTACGTACTTTTGAGAATTAATATTCAATTTTATTACAGCCTCGTGAAGTACGCAATCCCCATTATTAT TCTCACAAATACTACAGTACAATTTGTGATATCTTAGTATTCTGGAGATTGCGGTCTTTCTTGCTTCCATAGCTCTTTTA GAGTTAACTGAGATACTCATTCCATCTTCGACTCTTGTTGAACAAGCTCTAACTAGTTTCCCATTAACCTCAACTAGGCA TGAAT