SSO2847

Coordinates:1387095-1387403

>r_klactIV4093 1387095 1387403 103
MDQDEEPEFTRILWCLLCQGPVDLTPFVMWLAITFAHDRKTTESFRFSFLSLLSALLVALSKEFKIVYRAREVTCKMVDS
ISLVMPLYLIPSEITYLLVTSDR

>r_klactIV4093 1387095 1387403 103
ATGGACCAAGATGAGGAGCCGGAATTCACACGCATTCTATGGTGTCTTCTATGTCAGGGTCCAGTAGATCTTACTCCTTT
CGTAATGTGGCTAGCTATTACGTTTGCTCATGACAGGAAAACGACAGAAAGCTTTCGTTTTTCTTTTCTTTCGTTACTAA
GTGCGCTTTTAGTTGCACTTAGTAAAGAATTTAAAATTGTCTATAGAGCTAGAGAGGTTACCTGCAAAATGGTGGATTCA
ATTTCTCTGGTTATGCCACTGTATTTGATTCCTTCGGAAATAACTTATCTTTTAGTAACCAGCGACAGA


Kluyveromyces lactis Chromosome IV

Sequence spaning coordinates : 1386595 - 1387903 (Additional range around SSO2847 is :500nt.)

>Kluyveromyces lactis Chromosome IV TTGATGTTTTGTACGTCACACAGTTGCACATCACCAAATAAGCAGATGAATAGGAAGAGAAAGAAAGATATACACCTGAG AAAATACCCACCAGGATGATGATCGTAGGAACTATGATCAACAAGGAAGAATGAGAGTGTTATTCAAGTCATTAATATGT TGTCTTTGGGAGATGAGTGGCCTTGCAATAGAGGTCATATGACCATCGGACCTTTTCTCGTGCAAATGATGGACGGAAGG TGGGACGAAAACACGTGAAGGAGTTCTTCCTTCTCTTTTACTTGGTCGTAAGTTCCCGTTGCTAGCCGTGCAACGTTTCG CAAAGGCCCAGTCCTAAAGTACGAACAAGCTGTATATAGTGAAAAAATTGGAGATTGGCACTCTACACCCATACATCACA CTTCACGTATGGGCATTCGTGTGAGATCAATTTGACACAAAGGGGAAAGGGTTTTGCTACTTGCGACAGGAGGTATGGAG AAGTGTGTAACTGATTCATC ATGGACCAAGATGAGGAGCCGGAATTCACACGCATTCTATGGTGTCTTCTATGTCAGGG TCCAGTAGATCTTACTCCTTTCGTAATGTGGCTAGCTATTACGTTTGCTCATGACAGGAAAACGACAGAAAGCTTTCGTT TTTCTTTTCTTTCGTTACTAAGTGCGCTTTTAGTTGCACTTAGTAAAGAATTTAAAATTGTCTATAGAGCTAGAGAGGTT ACCTGCAAAATGGTGGATTCAATTTCTCTGGTTATGCCACTGTATTTGATTCCTTCGGAAATAACTTATCTTTTAGTAAC CAGCGACAGA TGAGCAGCGGCATACATTTCGTGCGAAACGAAAAAGAAAATTGTTTCCTCTCGAGTGATGCGGATTTGT GTAGGGAAGAAAAAGATGTAGCCAGAAAACACTGCAATGCACGAGGTGGCCTATATTTTTTTTCACTTAAATGGTTACAG GCCTGAAAAAAGTTTCAACTGCAAAGGTTACAGATCTGAGGGTGGGGGAGAAATCGGACCTGAGATGTCAGATCGGAACT TCTTCTTCTTCCCTCTGTTTCTCAGTGAGAGCGGGGTAGATAGTTGATAAATCACTAACGGTTTTTCTGTTTCCATTGAA TAAAATAGTATTAAAAACGTTATAAAAGAACATATTTCAAGAGTACTTAGTGATTTTGAAAGTGTGCAATGTTGGATAAA ATTAAGACAAGCCAGTTAGTATCTGCTAAAGATAAAATTCATTCTGACGAATTTTACACACCAGTTGTAGTTTGATTGTA CGTCAATTGTTCTTGTACGCGAAGCGCAGC