SSO2863

Coordinates:2618490-2620490

>SSO2863 acetyl-coenzyme A synthetase
MSVTWALPFDQKINPKLNLNRLVSITTYKEIHSQTVKDYKQFWASVASEIDWFKPWEKTLDDSNPPFYKWFVGGELNASY
LTVDRHVKSWRKNKVAIIWEGEPVDEKGNPKEVRKLTYYDLYREVNRVAYLLKEKYGLKKGDAIAIYLPMIPELPIFMLA
AARIGVVFTVVFSGFSADALASRINDAEAKLLITADGGWRRGKVVDLKGIVDKALEKTPTIKDVIVVRRIGNKVNMVEGR
DKYFDEVIKDIPQNVYVEPERMKSEDPLYILYTSGTTGKPKGIVHDIGGYMTLLHATMKWVFDIRDDDIYWCTADIGWVT
GHSYIVFGPLMEGATEIMYEGALDYPQPDRWVSIIERYGITILYTSPTAIRSFMKYGDNWVKAHITSTVRLMHSVGEPIN
PEAWEWLWKLVGREEVPFGSTWWMTETGGILISHLPGLYLVPMKPGTNGPPILGIEPDVVNEDGKQVNLEERGYLVIKNP
WPGMPLTIYKDPERYVKVYWSRFPGMFYVGDYAVKDKDGYFWILGRADEVIKVAGHRLGTYELESALIEHPAVAEAAVIG
VPDPVKGEVPYAFVILRQGYTPNTQLSQEILKTVRDKVGPIATIDKIFFVGKLPKTRSGKIMRRVVRAVATRAEVGDITT
LEDEASVEEIKKALEEFKAEFEKINK

>SSO2863 acetyl-coenzyme A synthetase
ATGTCAGTAACGTGGGCTCTACCTTTTGATCAAAAGATAAACCCAAAACTGAATTTAAATAGGCTAGTAAGTATAACTAC
GTATAAAGAGATTCACAGCCAAACGGTAAAAGATTACAAACAATTTTGGGCATCTGTAGCCTCGGAAATTGACTGGTTCA
AACCATGGGAGAAAACACTAGACGATAGTAATCCTCCATTCTATAAGTGGTTCGTAGGTGGAGAGCTTAACGCCTCTTAT
CTAACTGTAGATAGGCACGTTAAGAGCTGGAGGAAGAATAAGGTTGCCATAATATGGGAAGGAGAACCAGTGGACGAGAA
GGGAAACCCAAAGGAGGTTAGGAAGTTAACATATTACGATCTATATAGGGAAGTTAATAGAGTAGCCTATCTCTTGAAGG
AGAAATACGGGTTAAAGAAAGGTGATGCAATAGCGATTTACCTTCCAATGATACCGGAATTACCAATATTCATGTTAGCT
GCTGCTAGGATCGGAGTAGTCTTTACGGTGGTGTTCTCAGGATTTAGCGCTGACGCATTGGCAAGTAGGATTAATGACGC
CGAAGCCAAGTTACTAATTACCGCAGATGGTGGATGGAGAAGGGGTAAAGTTGTTGACTTAAAGGGAATTGTAGATAAGG
CTTTGGAGAAGACCCCAACAATAAAGGATGTAATAGTAGTTAGAAGGATAGGTAATAAGGTCAACATGGTTGAAGGTAGG
GATAAGTACTTTGATGAAGTAATCAAGGACATTCCACAAAATGTTTACGTTGAACCAGAAAGGATGAAATCTGAAGACCC
GTTATATATACTCTACACCTCTGGAACCACTGGAAAACCTAAGGGTATAGTCCACGATATTGGAGGGTATATGACATTAT
TACACGCTACAATGAAGTGGGTATTCGATATAAGGGATGACGACATTTACTGGTGTACCGCAGATATAGGATGGGTTACT
GGACACTCTTACATTGTGTTTGGACCATTAATGGAAGGAGCAACTGAAATAATGTATGAAGGAGCCTTGGATTATCCACA
ACCGGATAGGTGGGTATCGATAATTGAAAGGTATGGGATCACAATCCTTTATACCTCACCCACTGCAATTAGAAGCTTCA
TGAAATATGGTGATAATTGGGTTAAGGCTCACATTACCTCCACTGTTAGGCTAATGCATTCTGTAGGTGAACCAATAAAT
CCGGAAGCTTGGGAGTGGCTATGGAAATTAGTCGGTAGAGAGGAGGTACCATTTGGAAGCACTTGGTGGATGACTGAGAC
TGGAGGTATTCTAATATCTCATTTACCAGGATTGTATCTTGTGCCAATGAAACCTGGGACAAATGGCCCACCAATATTGG
GAATTGAGCCAGATGTAGTTAATGAAGATGGGAAACAAGTTAACCTTGAGGAAAGAGGATATCTTGTTATAAAGAATCCG
TGGCCTGGAATGCCATTAACAATTTACAAGGATCCTGAAAGATACGTGAAGGTGTATTGGAGTAGATTCCCTGGAATGTT
CTATGTTGGTGATTACGCTGTTAAGGACAAGGATGGATACTTCTGGATATTAGGGAGGGCTGATGAAGTTATCAAGGTAG
CTGGGCATAGGCTAGGTACATATGAGTTAGAATCAGCTTTAATTGAGCATCCTGCAGTTGCGGAAGCAGCGGTAATTGGA
GTCCCAGACCCAGTTAAGGGAGAGGTGCCTTATGCGTTTGTAATTTTGAGGCAAGGTTATACACCTAATACGCAGCTTTC
ACAAGAGATACTGAAGACGGTAAGAGATAAGGTGGGACCTATAGCTACTATAGATAAGATATTCTTCGTGGGTAAGTTGC
CTAAAACGAGAAGTGGAAAGATAATGAGAAGAGTTGTAAGGGCTGTTGCAACTAGGGCAGAAGTGGGAGATATAACTACA
TTAGAGGATGAGGCTTCTGTAGAGGAGATTAAAAAAGCTTTAGAGGAGTTTAAGGCAGAGTTTGAAAAGATCAACAAATA
A


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2617990 - 2620990 (Additional range around SSO2863 is :500nt.)

>Sulfolobus solfataricus P2 CAAGTAGGAAGAACGTTATCCACAGTAATAGAAATGTCATGAATAATCCTAGATTTGCCTTAAACGTGCCAAACCACATT GCTAGCGTAAAGATTCCAAACGCAATTAATACCAAGCCTATAGCTTGAGGTGTGACTCCTCCAAAAAATCCTCCCGCAGT TAGGAAATACCACTCCCAAAATGCACCATAAGTAAAGAAGGCAGTATAGCCAAAAGTGTTCCCTGCCCTCCATTCCAATA TTCCGGCTAGTAGTTGAGCCAATCCTCCATAAAACGCTGCTAGTCCCAACACAACAGATGCCCCTTGTGTTATTAACCCT GCATTGAAGGTAGATAACACGAGTGTAGTTAGTGCGAAACCAGAAAGTCCTAAGGGGGCTGGATTTGCCCTTTTTTGTTC TGTCATGACATCTTTATATAGCAATAATATACTTATAAAGTTTATTACCTTACAGTATTCTACTTAACATTTATTACCTA GAATTCCATTATATAACAT ATGTCAGTAACGTGGGCTCTACCTTTTGATCAAAAGATAAACCCAAAACTGAATTTAAAT AGGCTAGTAAGTATAACTACGTATAAAGAGATTCACAGCCAAACGGTAAAAGATTACAAACAATTTTGGGCATCTGTAGC CTCGGAAATTGACTGGTTCAAACCATGGGAGAAAACACTAGACGATAGTAATCCTCCATTCTATAAGTGGTTCGTAGGTG GAGAGCTTAACGCCTCTTATCTAACTGTAGATAGGCACGTTAAGAGCTGGAGGAAGAATAAGGTTGCCATAATATGGGAA GGAGAACCAGTGGACGAGAAGGGAAACCCAAAGGAGGTTAGGAAGTTAACATATTACGATCTATATAGGGAAGTTAATAG AGTAGCCTATCTCTTGAAGGAGAAATACGGGTTAAAGAAAGGTGATGCAATAGCGATTTACCTTCCAATGATACCGGAAT TACCAATATTCATGTTAGCTGCTGCTAGGATCGGAGTAGTCTTTACGGTGGTGTTCTCAGGATTTAGCGCTGACGCATTG GCAAGTAGGATTAATGACGCCGAAGCCAAGTTACTAATTACCGCAGATGGTGGATGGAGAAGGGGTAAAGTTGTTGACTT AAAGGGAATTGTAGATAAGGCTTTGGAGAAGACCCCAACAATAAAGGATGTAATAGTAGTTAGAAGGATAGGTAATAAGG TCAACATGGTTGAAGGTAGGGATAAGTACTTTGATGAAGTAATCAAGGACATTCCACAAAATGTTTACGTTGAACCAGAA AGGATGAAATCTGAAGACCCGTTATATATACTCTACACCTCTGGAACCACTGGAAAACCTAAGGGTATAGTCCACGATAT TGGAGGGTATATGACATTATTACACGCTACAATGAAGTGGGTATTCGATATAAGGGATGACGACATTTACTGGTGTACCG CAGATATAGGATGGGTTACTGGACACTCTTACATTGTGTTTGGACCATTAATGGAAGGAGCAACTGAAATAATGTATGAA GGAGCCTTGGATTATCCACAACCGGATAGGTGGGTATCGATAATTGAAAGGTATGGGATCACAATCCTTTATACCTCACC CACTGCAATTAGAAGCTTCATGAAATATGGTGATAATTGGGTTAAGGCTCACATTACCTCCACTGTTAGGCTAATGCATT CTGTAGGTGAACCAATAAATCCGGAAGCTTGGGAGTGGCTATGGAAATTAGTCGGTAGAGAGGAGGTACCATTTGGAAGC ACTTGGTGGATGACTGAGACTGGAGGTATTCTAATATCTCATTTACCAGGATTGTATCTTGTGCCAATGAAACCTGGGAC AAATGGCCCACCAATATTGGGAATTGAGCCAGATGTAGTTAATGAAGATGGGAAACAAGTTAACCTTGAGGAAAGAGGAT ATCTTGTTATAAAGAATCCGTGGCCTGGAATGCCATTAACAATTTACAAGGATCCTGAAAGATACGTGAAGGTGTATTGG AGTAGATTCCCTGGAATGTTCTATGTTGGTGATTACGCTGTTAAGGACAAGGATGGATACTTCTGGATATTAGGGAGGGC TGATGAAGTTATCAAGGTAGCTGGGCATAGGCTAGGTACATATGAGTTAGAATCAGCTTTAATTGAGCATCCTGCAGTTG CGGAAGCAGCGGTAATTGGAGTCCCAGACCCAGTTAAGGGAGAGGTGCCTTATGCGTTTGTAATTTTGAGGCAAGGTTAT ACACCTAATACGCAGCTTTCACAAGAGATACTGAAGACGGTAAGAGATAAGGTGGGACCTATAGCTACTATAGATAAGAT ATTCTTCGTGGGTAAGTTGCCTAAAACGAGAAGTGGAAAGATAATGAGAAGAGTTGTAAGGGCTGTTGCAACTAGGGCAG AAGTGGGAGATATAACTACATTAGAGGATGAGGCTTCTGTAGAGGAGATTAAAAAAGCTTTAGAGGAGTTTAAGGCAGAG TTTGAAAAGATCAACAAATAA GATACAAGAAATTAATATTTTTTTATAATTCTATGTAGGTAGATTTTTAAGAATGCTT ATACATTATTATATCAATGGATTCTCAAAACTATGATATTGAAAAAATTTTACAGAGATACGATAGCGATTATGTATTTC ATTATTTAGGTGTGAAAATTTTAGAGATAAAGGAGGGATATGCTAAAACACAAATACCGTTCAAGAAGGAGCTGACAAGA AGGGGAAATATTCTAAATGGTGGAATGATAGTTGCGTCCATAGACTACACAGGTGGATTGGCAGTTCTATCAATAAACGA TGGAATGGATCAGGTAACACAAGAACTAAAGGTAAATTTCCTAGAGCCAATGTATAGGGGGCCGTTTACTGTTGAAGCAA ATGTAATAAGAAAAGGTAGAACTGCAGTTACAGTGGAGATTACTTTTAAAGACGTTGAGGGAAGTCTTGGGGCGATTGGA TTGGGAACGTGGTACATAATAAGGGATAAGAAAATTAACATG