SSO3248

Coordinates:2988756-2989226

>SSO3248 hypothetical protein SSO3248
MEVIDPHARVADLVGLLYSLENTFNGKTDLYMLEKEMEVDLDDLMPIVYTANSLGFITVGEGDIIITDKGIEFLKSNLKR
RKEIIKDSIKKIEPFKTTLELKYFTIEELKYVLEKKGIQVYNSPEGLYDLQITLVEWGVYSGLLKKEGERFIVVTT

>SSO3248 hypothetical protein SSO3248
GTGGAAGTTATAGATCCGCATGCGAGAGTAGCAGATTTAGTGGGACTTTTGTACTCTTTAGAAAACACGTTTAATGGTAA
GACAGATCTATACATGCTAGAAAAGGAGATGGAAGTGGATTTAGACGATTTAATGCCAATAGTGTATACTGCAAATTCCT
TAGGTTTCATAACAGTAGGTGAGGGAGATATTATAATAACCGATAAAGGAATTGAGTTCCTTAAATCGAATCTTAAGAGA
AGAAAAGAAATCATCAAAGATTCAATAAAGAAAATTGAACCATTTAAAACAACGTTAGAATTGAAGTATTTTACGATAGA
AGAACTAAAATATGTTCTAGAAAAGAAAGGAATTCAAGTTTACAATAGCCCAGAGGGTCTTTATGACTTACAGATCACTT
TAGTTGAATGGGGAGTTTATTCTGGATTGCTGAAAAAGGAAGGAGAGAGGTTTATTGTAGTTACGACTTAG


Sulfolobus solfataricus P2

Sequence spaning coordinates : 2988256 - 2989726 (Additional range around SSO3248 is :500nt.)

>Sulfolobus solfataricus P2 ATAAAATTCCTTTTTAGACTCATTTAATGTTTCCACGATATTATACTTATACAGTATTATTTTAAAAAGTAAACGTCATG CTACTACGCTTTTATAAAGGTTTATGGTAAAGATATAAAAGGAATCATGAAGCTAATTTATTTCTCACTTCTCTTAACCG CTGTATCCCTATTAATAGGAAGTATAATGCTATTTAATACTGTACCAAGAATTTTCACAATCGGTACATTAGCTATAGTG ATGTTTCTGATTGCGTCCTTGTTTTTAATTAATAAATATAATTTCTTAACTTATATATTATTCGTATTAGCAATATTAGC TATAATTATATCCTCTTCTTCCGGAGCACATGTACAAGCTTTTAGAGAATTTGGCGAATCCTTATACATCACAGCTCTGG ATATTTTAATGATCTTAGGTTTCTATGTAGGGCCAATCCTATACATAGTAGCGTTCCTTAAAGATAATTTAAAAAGGTAA GAGTAATATAATTTAATTCT GTGGAAGTTATAGATCCGCATGCGAGAGTAGCAGATTTAGTGGGACTTTTGTACTCTTT AGAAAACACGTTTAATGGTAAGACAGATCTATACATGCTAGAAAAGGAGATGGAAGTGGATTTAGACGATTTAATGCCAA TAGTGTATACTGCAAATTCCTTAGGTTTCATAACAGTAGGTGAGGGAGATATTATAATAACCGATAAAGGAATTGAGTTC CTTAAATCGAATCTTAAGAGAAGAAAAGAAATCATCAAAGATTCAATAAAGAAAATTGAACCATTTAAAACAACGTTAGA ATTGAAGTATTTTACGATAGAAGAACTAAAATATGTTCTAGAAAAGAAAGGAATTCAAGTTTACAATAGCCCAGAGGGTC TTTATGACTTACAGATCACTTTAGTTGAATGGGGAGTTTATTCTGGATTGCTGAAAAAGGAAGGAGAGAGGTTTATTGTA GTTACGACTTAG CGTAATGCTAGAGAAGTATAAAAATAAAATTAAACAAAAAGTGTCTTATGGAAAAAGAAAAGGGAGA GGAGCTAGTTCATTACATTCACGAAGCTGACATATTTAGGACTAAGGTCTTCGGTATACAAGACGGTTTAATAGGAGTAG GCGCAATAGCGTTAGGAGCTGCCGGATTTTCCCATGATGCAATCGCAGTACTAGTAGCTGGTTTAATTGCAACAATCGGA CAGGCGTTCTCTATGGGAATTGGGGAATATATTAGCACTAGAGTTAGAATGCAAGTTATTCAGAACGAGATAAGAAAGGA AAAATATCAGTTAAAGAAGTTCCCCGAAATGGAAAAACAAGAACTGGTTAATTTTTACATGAAGAAGGGTTTTACTAAAG AAGTTTCAGAAAAAATAGCTGATTACTTGCTCAAAAATGAAGACGTAGCGTTGGAGGAAATGTTAATGCATGAACTTAAA GTATTCCCAGAGGAGTTTGAGCGCCCAGTTAA