SSO6176

Coordinates:500889-501158

>SSO6176 90 aa !not a gene!
MVIATSLVGLSASLTSKSVLPPLVTQNTSSSNPLICVLSLLSKSSGIRSGNNTSSCPVESRKFLIIPIIFCLSLNPYGIH
TPIPFIGYLP

>SSO6176 90 aa !not a gene!
GTGGTTATTGCGACTTCACTAGTTGGTCTTAGCGCAAGTTTAACGTCTAAGTCCGTGCTTCCTCCCTTAGTTACCCAGAA
TACCTCCTCTTCAAATCCTTTAATATGCGTGCTTTCTCTCCTTAGCAAATCTTCTGGGATTAGAAGTGGAAACAATACTT
CCTCATGTCCAGTAGAGTCTAGAAAATTTCTAATTATTCCTATTATATTTTGTCTTAGCTTAAATCCATATGGCATCCAT
ACTCCCATACCTTTTATTGGATATCTCCCA


Sulfolobus solfataricus P2

Sequence spaning coordinates : 500389 - 501658 (Additional range around SSO6176 is :500nt.)

>Sulfolobus solfataricus P2 AGGAGGTAAAACCGGTCCGTGATCATCTCCATGTATTGCAATTACTGAAGCTACTGCTCTGTCTGAAATACCATAACTTG TTTGGTGTGGATAGTCTAAACTACCATCTTTTTTCTGTATCTTAAAATCTAATGCCTTACTAAAGTTTTGACCTAAGTGA TGCACTGTACCTATTTGCATTGCTCTACCATCCGGCATAATAGTATCGAAAGCATAAGTGTGCAAAGCTCCGGCAAATCT ATCCCACTCTGGTCTTTCAGAAAGGACGTATGGGATTGTGAGAGTGTCAAAAATCTTCTTATAAATTTCTATTGCCTCTT CTACTTGTTTCTGTGCATCATCGTAAGTTTCATGAACCGTATGGGCTTCTTTAAAAGTTGTAATTTCTCTTAATCTTATC ATTGGCCTAGTAGCCTTAGTTTCATATCTAAAGACGCTTACAATTTGATAGTACTTTTTAGGTAATTGCTTGTAGCTTTT CAACCATAAGTTTTCCATT GTGGTTATTGCGACTTCACTAGTTGGTCTTAGCGCAAGTTTAACGTCTAAGTCCGTGCTT CCTCCCTTAGTTACCCAGAATACCTCCTCTTCAAATCCTTTAATATGCGTGCTTTCTCTCCTTAGCAAATCTTCTGGGAT TAGAAGTGGAAACAATACTTCCTCATGTCCAGTAGAGTCTAGAAAATTTCTAATTATTCCTATTATATTTTGTCTTAGCT TAAATCCATATGGCATCCATACTCCCATACCTTTTATTGGATATCTCCCA TAATCGTAAAATTCTCCTTCTCTTAATAC CCAATCAAACCATTCACTAAAGTTTTTTGACCACTTCTCTCTAGTTATCTGCACAAAAAGGAAAAAACATAAGGAGATAA AAAACTTTAACCTTTATTTTAGAACTTACCGAACAACATTAGTACAGCGAACAAGATTCCGTATACTGCTATTCCTTCAC CAATAGCTACGAAAATTAGAACTGTACCGAACATATCTCTTCTTTCCGTTAGTACACCCACTCCAGCTGCTGCTGCCATA CCAACTGCTATTCCGGCTCCTATCGCAGCTAAACCAACTGCTAGTCCTGCACCTATGTTAATACCGGCAAAACCTTGTGC AGTATCTGATGGTGCTTGTGCTGCTGCTATTACACTACTTACTAATACTGGTATTAGGAAGGCTAGGATCAAACTAGCTC TCTTCATAGTTAAGTCCCAGAAAACTATTATGACAATTCCTTTAAAACCTTTCTTTTTACTTCATCTAACT