SSO6180

Coordinates:502187-502360

>SSO6180 58 aa !not a gene!
MITTYITNMSFISFSSSSVLSLLWQFYTLFNSHYLISNKFLQSLELFLRSFYKLRTYH

>SSO6180 58 aa !not a gene!
TTGATCACAACTTATATAACCAACATGTCCTTTATCTCCTTTTCTTCTTCCTCTGTTCTCTCTCTTCTTTGGCAATTTTA
CACCCTATTTAATTCACACTATTTAATCTCTAATAAGTTTTTGCAATCCTTAGAACTGTTTTTGCGTTCATTTTACAAAT
TACGCACTTATCAT


Sulfolobus solfataricus P2

Sequence spaning coordinates : 501687 - 502860 (Additional range around SSO6180 is :500nt.)

>Sulfolobus solfataricus P2 TTACAGCTACAGCCCCAGCTTCCTCCGCTATTTGAGCCTGCTGAACGTTTGTAATATCCATGACGACTCCTCCCTTTTGA AAGATTGGAAATGCATGCTTCACTCTAGTAGTTCCCGTATGGACAGTTGAATCCAATTTTTTAAATTCTGGTAGAAATTC TAATAGACCATGATCTTTTATAATATCTTTAACTTCTGCTAGTTTATAGAAAAAATCTTCAATTTGTGCAAAAGATAATT CATAAAGTCTCATTTCATCACATATTCTGACTAAAGGTTTAAAAGCCTATCTTAAACGAGCTTTTTGCTTTCTCTCATTT TCTGCTCTTATCTTAATAATACCCAAAAATACCGCACAATTCACACAGTAACACTTAGTTACAGGATATCTAGCAATTAT TGCACCCTTCTTTTCTAATTCAGATGCTAGAGAAGCATCCACGGGGCTATACATTTTTGTTACACATACTGCCTTATCCT CTGGTACTCTAGCACCACA TTGATCACAACTTATATAACCAACATGTCCTTTATCTCCTTTTCTTCTTCCTCTGTTCTC TCTCTTCTTTGGCAATTTTACACCCTATTTAATTCACACTATTTAATCTCTAATAAGTTTTTGCAATCCTTAGAACTGTT TTTGCGTTCATTTTACAAATTACGCACTTATCAT TAACTTCTCTCTTCTCTATTGGATAACCTAGTACTCTCGCATTGG TAAGTTCCTCAATTTTTAAGCCACACTCGTTACTTCCACACCAAGGGACTTCTACAATACCTGAGTTATTCCCTAATATC TTCTTAGCTTTTTCAATATCATTCGAATACTCTATTCTAGATTTAAGATCCTCCCAAGCCTTTCTTCTTAAGTCTTCCTG GATTTCATTTAGAAGTTCTTTAATCTTATTGATGGCTTCTTCTTTCCTTACAGTATAAGACTTAAAATTGTCTCTTCTCT TTATAAATACTGTGCCAGAAATAAGCTCCCTTGGGCCGATTTCTAGTCTAATTGGAACTCCCTTAATTTCCCAAATATAG AACTTCTCCCCAGGTGTTTTCTCAGTATCTTGATCAGTCAAACAAGTTATATTGTTCTTGTTAAACATCTCACAGATCTC AATTGAGTATTTCATTACTTGTTGAGTTTCCTCTTCATTTTTTGCAGGAATGGGT